ESTScan Details for Unigene SGN-U578797

Score 
924
Direction 
Forward
Predicted Peptide Sequence 
KKRFEFIGETFDSVTVQNDTTNSRHASSNYDKNIELKAFDDTKAGVKGLVDAGITQVPRIFIHPEVSGSGPSPSLEETRFVFPIIDLENI
NKDPIKHKEIVKKVGDASETWGFFQVINHGIPMSVLDEMLRGARGFFEQDIDVKKKYYHRDYTRRVVYNSNFDLYNPKALAVNWRDSLYS
TMGPEPFNPEELPEACREIVMEYSHHVMKMGCTLLELLSESLGLKTSHLKEMECSEGLSILCNYYPSCPQPDLTIGLSKHTDNDFFTILL
QDDIGGLQVLHHNHWVDVPPTPGALVINIGDVLQLISNDKYKSVDHRALSNKIGPRISIASFFSSGPLPSSKLYGPIXGVLSENNPPKYR
ATTLKDFYDHFSQKGLDGNFNLSHYKSX
Predicted Coding Sequence 
AAGAAGAGATTTGAATTTATCGGTGAAACTTTTGATTCCGTCACCGTACAAAATGATACAACAAATTCAAGACACGCCTCATCAAACTAT
GATAAAAATATAGAGCTAAAAGCCTTTGATGACACGAAAGCCGGTGTTAAAGGCCTTGTTGATGCTGGAATTACTCAAGTACCTCGGATA
TTCATCCATCCAGAGGTTTCAGGCTCGGGGCCTTCCCCGAGCCTGGAGGAAACACGTTTTGTTTTTCCAATAATAGATCTCGAAAACATC
AATAAAGATCCTATCAAGCACAAAGAGATTGTTAAAAAAGTTGGTGATGCTTCAGAGACATGGGGATTCTTCCAAGTGATCAATCATGGT
ATTCCGATGTCAGTCCTGGATGAAATGCTACGAGGAGCACGAGGTTTCTTCGAGCAAGATATTGACGTTAAGAAGAAATATTATCATCGC
GATTATACACGGAGAGTGGTGTATAATAGCAATTTTGATTTGTATAACCCTAAGGCTTTAGCAGTAAATTGGAGAGACTCACTTTATTCT
ACTATGGGTCCTGAGCCTTTTAATCCTGAGGAATTGCCTGAGGCTTGCAGGGAAATAGTAATGGAGTACTCACACCATGTAATGAAAATG
GGATGCACTCTGCTTGAGTTACTCTCAGAGTCTCTTGGTCTAAAAACAAGTCATCTCAAAGAAATGGAATGTTCAGAGGGTCTTAGCATT
TTGTGCAATTACTATCCATCATGTCCACAGCCAGATTTAACCATAGGTCTTAGCAAACATACAGACAATGATTTCTTCACAATCCTTCTA
CAAGATGATATTGGAGGTCTCCAAGTTCTTCATCACAATCATTGGGTTGATGTTCCTCCTACACCTGGAGCTTTAGTTATCAATATCGGA
GATGTTCTCCAGCTCATATCAAATGACAAGTACAAAAGTGTAGATCATAGAGCATTGTCAAACAAAATAGGTCCAAGAATATCAATAGCA
AGCTTTTTTAGCTCAGGGCCATTGCCATCTTCCAAACTCTATGGACCAATTGANGGAGTACTATCAGAAAACAATCCTCCAAAGTATCGT
GCAACGACACTGAAGGACTTCTATGATCATTTCAGCCAGAAAGGACTTGATGGAAACTTCAATCTATCTCACTACAAATCTAAX
Edits in Original Sequence 
(5')AAGAAGAGATTTGAATTTATCGGTGAAACTTTTGATTCCGTCACCGTACAAAATGATACAACAAATTCAAGACACGtCCTCATCAA
ACTATGATAAAAATATAGAGCTAAAAGCCTTTGATGACACGAAAGCCGGTGTTAAAGGCCTTGTTGATGCTGGAATTACTCAAGTACCTC
GGATATTCATCCATCCAGAGGTTTCAGGCTCGGGGCCTTCCCCGAGCCTGGAGGAAACACGTTTTGTTTTTCCAATAATAGATCTCGAAA
ACATCAATAAAGATCCTATCAAGCACAAAGAGATTGTTAAAAAAGTTGGTGATGCTTCAGAGACATGGGGATTCTTCCAAGTGATCAATC
ATGGTATTCCGATGTCAGTCCTGGATGAAATGCTACGAGGAGCACGAGGTTTCTTCGAGCAAGATATTGACGTTAAGAAGAAATATTATC
ATCGCGATTATACACGGAGAGTGGTGTATAATAGCAATTTTGATTTGTATAACCCTAAGGCTTTAGCAGTAAATTGGAGAGACTCACTTT
ATTCTACTATGGGTCCTGAGCCTTTTAATCCTGAGGAATTGCCTGAGGCTTGCAGGGAAATAGTAATGGAGTACTCACACCATGTAATGA
AAATGGGATGCACTCTGCTTGAGTTACTCTCAGAGTCTCTTGGTCTAAAAACAAGTCATCTCAAAGAAATGGAATGTTCAGAGGGTCTTA
GCATTTTGTGCAATTACTATCCATCATGTCCACAGCCAGATTTAACCATAGGTCTTAGCAAACATACAGACAATGATTTCTTCACAATCC
TTCTACAAGATGATATTGGAGGTCTCCAAGTTCTTCATCACAATCATTGGGTTGATGTTCCTCCTACACCTGGAGCTTTAGTTATCAATA
TCGGAGATGTTCTCCAGCTCATATCAAATGACAAGTACAAAAGTGTAGATCATAGAGCATTGTCAAACAAAATAGGTCCAAGAATATCAA
TAGCAAGCTTTTTTAGCTCAGGGCCATTGCCATCTTCCAAACTCTATGGACCAATTGANGGAGTACTATCAGAAAACAATCCTCCAAAGT
ATCGTGCAACGACACTGAAGGACTTCTATGATCATTTCAGCCAGAAAGGACTTGATGGAAACTTCAATCTATCTCACTACAAATCTAAX
(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan