ESTScan Details for Unigene SGN-U578825

Score 
983
Direction 
Forward
Predicted Peptide Sequence 
XSVVADTAGGQYYRGILSFKGERSRSCIAFALGSHNHXAINKDFDXLAXKGPDMSGIIGRTMANRRISDLNKFLVGSRLFASRTYSSAVK
EMTVRDALNSALDEEMSADPKVFVMGEEVGEYQGAYKITKGLLAKYGPQRVIDTPITEAGFTGIGVGAAYHGLRPVIEFMTFNFSMQAID
HIINSAAKSNYMSAGQISVPIVFRGPNGAAAGVXCPTLSVLWAWYGACPGLKVLAPYSSEDARGLLKAAIRDPDPVVFLENELLYGESFP
ISAEALDSSFSLPIGKAKIEREGKDVTITAFSKMVGYAIKAAELLAKEGISAEVINLRSIRPLDRPAINASVRKTNRLVTVEEGFPQHGV
GAEICASVVEESFEYLDAPVERISGADVPMPYAANLERLAVPQVEDIVRAVKRFVTDQVNRSFPMAAAAWLGPAMP*
Predicted Coding Sequence 
XXTTCAGTGGTAGCAGACACGGCCGGGGGGCAATATTATCGGGGAATTTTGTCCTTCAAAGGAGAGAGGAGTCGGAGTTGTATAGCTTTT
GCTCTGGGGTCCCATAATCATCXCGCCATTAACAAGGATTTTGATXTTTTAGCTAAXAAAGGACCAGACATGTCTGGAATCATAGGTCGA
ACAATGGCCAATAGAAGGATTTCTGATTTGAACAAGTTCTTGGTGGGAAGTAGACTATTTGCATCTAGAACTTACTCTTCCGCAGTTAAA
GAGATGACAGTGCGTGACGCATTAAATTCAGCTCTAGATGAAGAAATGTCTGCGGATCCTAAGGTCTTCGTTATGGGGGAAGAGGTTGGT
GAGTACCAGGGTGCCTATAAGATTACAAAGGGACTTCTGGCAAAATATGGTCCGCAAAGGGTTATCGATACACCAATTACTGAGGCTGGA
TTTACTGGAATTGGAGTTGGTGCAGCTTATCATGGTCTAAGGCCCGTAATCGAATTCATGACATTCAACTTCTCCATGCAGGCAATAGAC
CATATTATCAATTCTGCTGCAAAATCAAACTACATGTCTGCTGGTCAGATATCTGTGCCCATTGTTTTCAGGGGTCCTAATGGTGCTGCA
GCTGGTGTCXGGTGCCCAACACTCTCAGTGCTATGGGCATGGTATGGTGCGTGTCCAGGATTAAAGGTACTAGCTCCATACTCTTCCGAA
GATGCTCGTGGCTTGCTCAAAGCTGCTATCAGGGATCCTGATCCTGTTGTGTTTCTGGAAAATGAATTGCTGTATGGTGAGTCTTTCCCT
ATTTCCGCTGAAGCTCTTGATTCTAGTTTCTCCCTCCCCATTGGAAAAGCTAAGATAGAACGCGAAGGGAAGGATGTGACCATCACTGCC
TTCTCAAAGATGGTTGGCTATGCGATCAAGGCTGCTGAACTTCTTGCCAAGGAAGGAATTAGTGCTGAGGTTATAAATCTGCGCTCGATC
CGACCACTTGATAGACCTGCCATTAATGCATCTGTGAGGAAAACCAACAGACTTGTAACTGTTGAGGAAGGATTTCCACAACATGGTGTT
GGCGCTGAAATCTGTGCATCTGTGGTTGAGGAGAGCTTTGAGTATCTTGATGCACCAGTTGAGAGGATATCAGGTGCTGATGTTCCTATG
CCATACGCTGCTAATCTTGAAAGACTGGCTGTTCCACAGGTAGAGGACATCGTTCGTGCAGTCAAGAGGTTTGTTACCGATCAAGTAAAT
AGATCATTTCCAATGGCTGCAGCTGCTTGGCTTGGTCCAGCGATGCCTTGA
Edits in Original Sequence 
(5')XXTTCAGTGGTAGCAGACACGGCCGGGGGGCAATATTATCGGGGAATTTTGTCCTTCAAAGGAGAGAGGAGTCGGAGTTGTATAGC
TTTTGCTCTGGGGTCCCATAATCATCXCGCCATTAACAAGGATTTTGATXTTTTAGCTAAXAAAGGACCAGACATGTCTGGAATCATAGG
TCGAACAATGGCCAATAGAAGGATTTCTGATTTGAACAAGTTCTTGGTGGGAAGTAGACTATTTGCATCTAGAACTTACTCTTCCGCAGT
TAAAGAGATGACAGTGCGTGACGCATTAAATTCAGCTCTAGATGAAGAAATGTCTGCGGATCCTAAGGTCTTCGTTATGGGGGAAGAGGT
TGGTGAGTACCAGGGTGCCTATAAGATTACAAAGGGACTTCTGGCAAAATATGGTCCGCAAAGGGTTATCGATACACCAATTACTGAGGC
TGGATTTACTGGAATTGGAGTTGGTGCAGCTTATCATGGTCTAAGGCCCGTAATCGAATTCATGACATTCAACTTCTCCATGCAGGCAAT
AGACCATATTATCAATTCTGCTGCAAAATCAAACTACATGTCTGCTGGTCAGATATCTGTGCCCATTGTTTTCAGGGGTCCTAATGGTGC
TGCAGCTGGTGTCXGGTGCCCAACACTCTCAGTGCTATGcGGCATGGTATGGTGCGTGTCCAGGATTAAAGGTACTAGCTCCATACTCTT
CCGAAGATGCTCGTGGCTTGCTCAAAGCTGCTATCAGGGATCCTGATCCTGTTGTGTTTCTGGAAAATGAATTGCTGTATGGTGAGTCTT
TCCCTATTTCCGCTGAAGCTCTTGATTCTAGTTTCTCCCTCCCCATTGGAAAAGCTAAGATAGAACGCGAAGGGAAGGATGTGACCATCA
CTGCCTTCTCAAAGATGGTTGGCTATGCGATCAAGGCTGCTGAACTTCTTGCCAAGGAAGGAATTAGTGCTGAGGTTATAAATCTGCGCT
CGATCCGACCACTTGATAGACCTGCCATTAATGCATCTGTGAGGAAAACCAACAGACTTGTAACTGTTGAGGAAGGATTTCCACAACATG
GTGTTGGCGCTGAAATCTGTGCATCTGTGGTTGAGGAGAGCTTTGAGTATCTTGATGCACCAGTTGAGAGGATATCAGGTGCTGATGTTC
CTATGCCATACGCTGCTAATCTTGAAAGACTGGCTGTTCCACAGGTAGAGGACATCGTTCGTGCAGTCAAGAgGGTTTGTTACCGATCAA
GTAAATAGATCATTTCCAATGGCTGCAGCTGCTTaGGCTTGGTCCAGCGATGCCTTGA(3')TTGTTCCAAAGCATTTAACTTCTATTTG
TGGATATCAATTCTTTATCCGCCTATAAGCGTATGCTTTCAGCCATCTTCTGGGAAGTTCAATTGACTGTAAAACCAGCCAAACTGGTAA
ACTAACGAATGAAATCTGCTGCCAGATTTTTCGGCCACGCAAGGAAATAGTTCTTGTAGAAAATAATACTTAACAGCTTTTTTCCCTTAA
AGAAAATGTTGTTACAAGAGAATACATGCGTTCTAGGAATTATCGAACTGCTGTGCCAATGTTTTTTTCTTTTTGTCTAATCATCTCTTT
AACTGGTGTTGTTGCTATAAAATGTTCAAGGAACAACTCCTCTTGGTGGATATGCGACATGACTCCTATTTTATTATGTTTTAGACAAAT
G

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan