ESTScan Details for Unigene SGN-U578859

Score 
1027
Direction 
Forward
Predicted Peptide Sequence 
MGGDNTEKITIMMLKVDLQCSSCYKKVKKILCKFPQIRDQVYDEKANIITITVLCCNPEKIRDKLCCKGGGVIKSIEIKESQKPKESEKP
KEPEKPKVVEKPKEPEKPKVVEKPKELEKPKVVVVEKPKEPEKPKVVVVEKPKESEKPKVVEKPKEPEKPKIVAVEKPKEAEKPKEPVKP
KEPEKPKEPEKPKEVQKPKEPEKPKEAPKPAPPVALPPQPQPQPQPQFPPVPEPVIVMPVQGYPHQPSPGMYCCGQCYEGYTGGPCYHDN
WYGRPVQPPPPPPCYDTYSYGYGPGPGPIPYGLPKGCYVNKCDYFSEENASGCSIM*
Predicted Coding Sequence 
ATGGGTGGTGACAATACTGAGAAGATTACCATAATGATGCTAAAGGTTGATCTTCAATGTTCAAGCTGCTACAAAAAAGTCAAAAAAATT
CTCTGCAAATTCCCTCAAATTCGAGACCAAGTGTATGATGAAAAGGCCAATATAATCACAATTACTGTATTGTGTTGCAATCCTGAAAAA
ATTCGTGACAAATTGTGTTGCAAAGGAGGGGGAGTAATCAAGAGCATTGAGATCAAAGAGTCTCAAAAGCCTAAAGAATCGGAAAAGCCT
AAAGAGCCCGAAAAGCCCAAGGTGGTGGAGAAGCCTAAAGAGCCCGAAAAGCCCAAGGTGGTGGAGAAGCCTAAAGAGCTCGAGAAACCT
AAAGTAGTAGTCGTGGAGAAGCCTAAAGAACCTGAGAAACCCAAAGTGGTGGTTGTAGAGAAGCCTAAAGAATCAGAGAAACCTAAAGTA
GTAGAGAAGCCTAAAGAACCCGAAAAACCTAAAATAGTGGCGGTGGAGAAGCCTAAAGAAGCTGAAAAGCCCAAAGAACCCGTGAAGCCC
AAGGAACCAGAGAAGCCTAAAGAGCCCGAAAAGCCAAAGGAGGTTCAGAAGCCCAAAGAGCCCGAAAAGCCAAAAGAAGCACCTAAACCA
GCACCACCAGTAGCTCTTCCCCCACAACCACAACCACAACCACAACCACAATTTCCGCCAGTTCCAGAACCAGTGATCGTGATGCCAGTT
CAAGGATATCCACACCAACCCTCTCCGGGGATGTATTGTTGTGGGCAATGTTACGAAGGCTATACTGGAGGCCCTTGTTATCATGATAAT
TGGTACGGAAGACCAGTACAACCACCTCCACCACCACCATGCTACGACACATATTCATACGGATATGGGCCCGGGCCCGGGCCCATACCC
TATGGACTCCCAAAGGGATGTTATGTGAACAAATGTGATTACTTTAGTGAAGAGAATGCATCTGGATGCTCAATTATGTGA
Edits in Original Sequence 
ACCAATCTTGATGATTTCATAAAATTTCAACTTTATACAACTTTCTCTATCTTAAGCCATCTCTACATCATTCATATTCATTCTATATAA
TAAAACTACATTTTTTTTCTTTTCCCTTCTCAAGTTTACCCAAAAAACCATAGATTAGTTATCACTTTTAAATATCAAAATTCTTAGTTC
TCAACT
(5')ATGGGTGGTGACAATACTGAGAAGATTACCATAATGATGCTAAAGGTTGATCTTCAATGTTCAAGCTGCTACAAAAAAGT
CAAAAAAATTCTCTGCAAATTCCCTCAAATTCGAGACCAAGTGTATGATGAAAAGGCCAATATAATCACAATTACTGTATTGTGTTGCAA
TCCTGAAAAAATTCGTGACAAATTGTGTTGCAAAGGAGGGGGAGTAATCAAGAGCATTGAGATCAAAGAGTCTCAAAAGCCTAAAGAATC
GGAAAAGCCTAAAGAGCCCGAAAAGCCCAAGGTGGTGGAGAAGCCTAAAGAGCCCGAAAAGCCCAAGGTGGTGGAGAAGCCTAAAGAGCT
CGAGAAACCTAAAGTAGTAGTCGTGGAGAAGCCTAAAGAACCTGAGAAACCCAAAGTGGTGGTTGTAGAGAAGCCTAAAGAATCAGAGAA
ACCTAAAGTAGTAGAGAAGCCTAAAGAACCCGAAAAACCTAAAATAGTGGCGGTGGAGAAGCCTAAAGAAGCTGAAAAGCCCAAAGAACC
CGTGAAGCCCAAGGAACCAGAGAAGCCTAAAGAGCCCGAAAAGCCAAAGGAGGTTCAGAAGCCCAAAGAGCCCGAAAAGCCAAAAGAAGC
ACCTAAACCAGCACCACCAGTAGCTCTTCCCCCACAACCACAACCACAACCACAACCACAATTTCCGCCAGTTCCAGAACCAGTGATCGT
GATGCCAGTTCAAGGATATCCACACCAACCCTCTCCGGGGATGTATTGTTGTGGGCAATGTTACGAAGGCTATACTGGAGGCCCTTGTTA
TCATGATAATTGGTACGGAAGACCAGTACAACCACCTCCACCACCACCATGCTACGACACATATTCATACGGATATGGGCCCGGGCCCGG
GCCCATACCCTATGGACTCCCAAAGGGATGTTATGTGAACAAATGTGATTACTTTAGTGAAGAGAATGCATCTGGATGCTCAATTATGTG
A(3')ATCTAACATGTTGGGCCATACTAGGGCCCTTTTTACATTTTAATTGGGCCTTTTCACCAAAAGTCCAAATCAAACTTTGGATCTA
TATGGCTATCTTTTTGTATGTCATTATTATAGATTTATTACTTATAGAAAATAAATATATAAGTTACTTACTTTTACAAGAAAATTTGAT
TAAGAGAGAATAATTTGGTTACCAGATTACTGGTTAACCGTCTTGTTACATAATTACTTTAAAAGTTTATTAATAAAAAGCACTTTGTTT
ATTAATTTGGTGCTAAGAAAGTTGTTGATTAATGTAGAAATAAATTAATACATTAATTTTTTCTCTTCAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan