Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U578936

Score 
609
Direction 
Forward
Predicted Peptide Sequence 
FLTNYASKRICVHPTPPSKVDRTKTKFNSXITALYWTFKLFWFQKKIMASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGA
DFLTKEVQFEDRLYTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFENLNNWREEFLIQASPSDPENFPFVVLGNKIDVDGGN
SRVVSEKKAKAWCASKGIPYFETSAKEGFNVDAAFQCIAKNALKNEPEEEIYLPDTIDVAGGNQPRSTGCEC*
Predicted Coding Sequence 
TTCTTAACTAATTACGCAAGCAAAAGAATTTGTGTCCACCCAACCCCTCCCTCGAAAGTTGATCGTACCAAAACGAAATTCAATTCAATX
ATCACTGCTCTTTATTGGACTTTTAAGCTTTTCTGGTTTCAAAAAAAAATTATGGCTTCTCGAAGGCGGATGCTGCTCAAGGTCATAATC
CTTGGCGATAGTGGGGTGGGAAAGACATCTCTGATGAACCAGTATGTGAATCGCAAGTTTAGCAACCAATACAAGGCCACAATTGGAGCT
GATTTCTTGACAAAAGAAGTTCAGTTTGAGGATAGGTTGTACACATTACAGATATGGGATACAGCTGGGCAGGAAAGGTTCCAAAGCCTT
GGCGTGGCTTTCTACCGTGGAGCAGATTGTTGTGTTCTAGTGTATGATGTGAATGTCATGAAGTCATTTGAGAACCTTAACAACTGGAGA
GAAGAATTTCTGATCCAGGCCAGCCCATCTGATCCTGAGAACTTCCCATTTGTTGTATTGGGGAATAAGATAGATGTTGATGGTGGCAAT
AGTCGAGTGGTGTCTGAGAAGAAAGCCAAGGCATGGTGTGCCTCCAAGGGGATACCCTACTTTGAGACCTCTGCAAAAGAGGGATTCAAT
GTGGATGCTGCATTCCAGTGTATAGCTAAAAATGCTCTGAAAAATGAACCTGAAGAAGAAATATATCTTCCCGATACTATTGATGTTGCT
GGAGGAAATCAACCAAGATCAACAGGATGTGAATGTTGA
Edits in Original Sequence 
(5')TTCTTAACTAATTACGCAAGCAAAAGAATTTGTGTCCACCCAACCCCTCCCTCGAAAGTTGATCGTACCAAAACGAAATTCAATTC
AATXATCACTGCTCTTTATTGGACTTTTAAGCTTTTCTGGTTTCAAAAAAAAATTATGGCTTCTCGAAGGCGGATGCTGCTCAAGGTCAT
AATCCTTGGCGATAGTGGGGTGGGAAAGACATCTCTGATGAACCAGTATGTGAATCGCAAGTTTAGCAACCAATACAAGGCCACAATTGG
AGCTGATTTCTTGACAAAAGAAGTTCAGTTTGAGGATAGGTTGTACACATTACAGATATGGGATACAGCTGGGCAGGAAAGGTTCCAAAG
CCTTGGCGTGGCTTTCTACCGTGGAGCAGATTGTTGTGTTCTAGTGTATGATGTGAATGTCATGAAGTCATTTGAGAACCTTAACAACTG
GAGAGAAGAATTTCTGATCCAGGCCAGCCCATCTGATCCTGAGAACTTCCCATTTGTTGTATTGGGGAATAAGATAGATGTTGATGGTGG
CAATAGTCGAGTGGTGTCTGAGAAGAAAGCCAAGGCATGGTGTGCCTCCAAGGGGATACCCTACTTTGAGACCTCTGCAAAAGAGGGATT
CAATGTGGATGCTGCATTCCAGTGTATAGCTAAAAATGCTCTGAAAAATGAACCTGAAGAAGAAATATATCTTCCCGATACTATTGATGT
TGCTGGAGGAAATCAACCAAGATCAACAGGATGTGAATGTTGA(3')AGATGATCTAATGATTTATTTACTACAAGACAGTTAAACTCTC
TGTATTTGATTTTAGATTCCGGATTCTTCTCTTGGGAAGTGTAATTATGATGTTGCACCTTAATTTTTTTTTCCTCCATGGATACTTATT
GATGTTTCAGACTCTATAATGATTCATGATAATGTACACTTGACTACACATTAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan