ESTScan Details for Unigene SGN-U579059

Score 
469
Direction 
Forward
Predicted Peptide Sequence 
MQSKDKKVLLQIKKDLGNPYHLASWDPNTDCCYWYVVKCDRKTNRINALTVFQANISGQIPAAVGDLPYLETLEFHHVTNLTGTIPPAIA
KLTNLKMLRLSFTNLTGPIPEFLXSAEEFDVARVELQSIYRNNPFFPLSASEFASDVLDRNKLTGTIPESFGRFKGPNIPDLYLSHNSLT
GHVPASLGDLNFSTLDFSRNKLEGDVSFLFGKNKTSQVIDLSRNLLEFDISKSEFAESLISLDLNHNRIFGSLPPGLKDVPLQFFNVSYN
RLCGQIPQGGTLQSFDIYSYLHNNAFVALPCRNVSRYGGRGFK*
Predicted Coding Sequence 
ATGCAATCCAAAGACAAAAAAGTCCTTCTACAAATAAAGAAAGACTTAGGCAATCCTTACCATTTAGCTTCATGGGATCCAAACACAGAT
TGCTGTTACTGGTACGTCGTAAAATGTGACCGGAAAACCAACCGGATAAATGCTCTCACCGTCTTCCAAGCCAATATCTCCGGCCAAATT
CCGGCAGCCGTCGGAGACCTTCCATATCTCGAAACATTGGAATTTCATCATGTTACTAATCTCACCGGAACAATTCCACCTGCAATTGCG
AAGCTCACAAATCTCAAAATGTTAAGGCTCAGCTTCACTAACCTTACAGGTCCGATCCCTGAATTCCTTAXGTCAGCTGAAGAATTTGAC
GTTGCTCGAGTTGAATTACAATCAATTTACCGGAACAATCCCTTCTTCCCTCTCTCAGCTTCCGAATTTGCTAGCGATGTACTTGATCGT
AACAAACTCACCGGAACAATACCGGAATCGTTTGGGAGATTTAAAGGACCAAATATACCAGATCTCTACCTTTCACACAACAGCTTGACC
GGACATGTGCCGGCATCTTTAGGTGATTTGAATTTTTCCACGCTTGATTTCTCCAGGAATAAGCTTGAAGGAGATGTTTCGTTTTTGTTC
GGGAAGAATAAGACGAGTCAGGTAATTGATTTATCGAGGAATTTATTGGAGTTTGATATTTCGAAATCGGAGTTTGCTGAGAGCTTGATA
TCATTGGATTTGAATCATAATCGAATTTTTGGTAGCTTACCACCAGGATTGAAAGATGTACCATTGCAGTTTTTCAATGTGAGTTATAAT
AGACTTTGTGGACAGATTCCACAAGGTGGAACGTTGCAGAGCTTTGATATTTACTCTTATTTGCATAACAATGCCTTTGTGGCTCTCCCT
TGCCGAAATGTAAGTAGGTATGGAGGTCGAGGATTTAAATAA
Edits in Original Sequence 
GCNTNACNGCCGGGGNNTGTTCATAAACAAAAAAAAAAAAGAAGAGAGAATATGAACTTGTCTCTTCTTCTTGTAGTTATTTTTCTTTGC
TTTGCTTCTCCTTCACTATCAGTAAG
(5')ATGCAATCCgAAAGACAAAAAAGTCCTTCTACAAATAAAGAAAGACTTAGGCAATCCTTA
CCATTTAGCTTCATGGGATCCAAACACAGATTGCTGTTACTGGTACGTCGTAAAATGTGACCGGAAAACCAACCGGATAAATGCTCTCAC
CGTCTTCCAAGCCAATATCTCCGGCCAAATTCCGGCAGCCGTCGGAGACCTTCCATATCTCGAAACATTGGAATTTCATCATGTTACTAA
TCTCACCGGAACAATTCCACCTGCAATTGCGAAGCTCACAAATCTCAAAATGTTAAGGCTCAGCTTCACTAACCTTACAGGTCCGATCCC
TGAATTCCTTAXGTCAGCTGAAGAATTTGACGTTGCTCGAGTTGAATTACAATCAATTTACCGGAACAATCCCTTCTTCCCTCTCTCAGC
TTCCGAATTTGCTAGCGATGTACTTaGATCGTAACAAACTCACCGGAACAATACCGGAATCGTTTGGGAGATTTAAAGGACCAAATATAC
CAGATCTCTACCTTTCACACAACAGCTTGACCGGACATGTGCCGGCATCTTTAGGTGATTTGAATTTTTCCACGCTTGATTTCTCCAGGA
ATAAGCTTGAAGGAGATGTTTCGTTTTTGTTCGGGAAGAATAAGACGAGTCAGGTAATTGATTTATCGAGGAATTTATTGGAGTTTGATA
TTTCGAAATCGGAGTTTGCTGAGAGCTTGATATCATTGGATTTGAATCATAATCGAATTTTTGGTAGCTTACCACCAGGATTGAAAGATG
TACCATTGCAGTTTTTCAATGTGAGTTATAATAGACTTTGTGGACAGATTCCACAAGGTGGAACGTTGCAGAGCTTTGATATTTACTCTT
ATTTGCATAACaAATGCCTTTGTGGCTCTCCCTTGCCGAAATGTAAGTAGGTATGGAGGTCGAGGATTTAAATAA(3')TCGAGAATTGT
AGTAGAGGCAACTAGCCTTCTCTAGTCGTTCCTAATCATATTTAGTGCTCTTTTCGCTTTTTATAATCCGTATGCGAGGATCTAATGAAT
ATAGTCTCTCTATCAATAAACTGGCATCTTCAAATTTCACTTATGAAATTGTACGGAGTATGTTATTGATC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan