Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U579181

Score 
1159
Direction 
Forward
Predicted Peptide Sequence 
SDSTTFVKSSASASLPTGQKDSKFTNFLFVHSRVSHSTSIMATSTMALSSSTFAGKAVKLSPSSSEITGNGRVTMRKTATKAKPASSGSP
WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIF
SEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF
VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPESEVFKKLVVXLIVNYKNIIIYMSIVIGCIKELFARDYSSINVLLSINNNALNYP
INKXVNVHIIYYTPNIKELINIYGNPTQITLIFIRVPRTKQLVNQASTAFFEWSLKFXLLHFMILHSSRNCTVKHPAIRQSNRWTMEKWF
PIFSNYIYDFPRLSIDYRLRIRIICDKTNTGNTTLKIIFHPFPHLITDFDFDLRFHHILTNRSSDDILTNIPDDHCNNIAAATAKGSPGY
TGNSIYDLFQHLF
Predicted Coding Sequence 
TCGGATTCGACAACGTTCGTCAAGTCCAGTGCATCAGCTTCATTGCCTACGGGCCAGAAGGATTCTAAATTTACAAATTTTCTTTTTGTA
CATTCAAGAGTTTCTCATTCTACTTCTATAATGGCTACTTCTACCATGGCTCTTTCTTCCTCTACATTTGCCGGAAAGGCGGTTAAACTC
TCCCCATCTTCTTCTGAAATCACCGGAAATGGGAGAGTCACCATGAGGAAGACTGCTACCAAGGCCAAGCCAGCCTCCTCTGGTAGCCCA
TGGTATGGTCCTGACCGTGTTAAGTACTTGGGACCATTCTCTGGGGAATCCCCAAGCTACTTGACCGGTGAGTTTCCTGGTGATTACGGA
TGGGACACTGCTGGACTTTCAGCTGACCCTGAAACATTCGCTAAGAACCGTGAGTTGGAGGTTATTCATTGTAGATGGGCCATGCTTGGT
GCTCTTGGATGTGTATTCCCCGAGCTTTTGGCCCGTAATGGTGTTAAGTTCGGTGAAGCTGTATGGTTCAAGGCTGGATCACAAATTTTC
AGCGAGGGTGGACTTGACTACTTGGGAAACCCAAGCTTGGTCCATGCACAAAGCATTTTGGCTATCTGGGCTTGCCAAGTTGTGTTGATG
GGAGCCGTTGAGGGTTACCGTATTGCTGGTGGGCCTCTTGGTGAGGTTGTTGACCCACTCTACCCTGGTGGTAGCTTTGACCCACTGGGC
CTTGCTGATGACCCAGAGGCTTTTGCTGAGCTCAAGGTAAAAGAGATCAAGAATGGTAGACTTGCTATGTTCTCCATGTTCGGATTCTTT
GTTCAAGCTATCGTCACCGGAAAGGGTCCATTGGAGAACCTTGCTGACCATCTCGCTGATCCAGTCAATAACAATGCTTGGGCCTTCGCC
ACAAACTTTGTCCCCGAAAGTGAAGTTTTTAAAAAATTAGTTGTTXTGCTAATTGTAAATTACAAGAACATAATAATATATATGAGTATT
GTTATTGGATGCATTAAAGAGCTGTTTGCAAGAGATTATTCATCTATAAATGTGTTGTTATCCATAAATAACAACGCATTGAATTACCCA
ATCAATAAAXCTGTAAATGTTCACATAATTTACTATACACCAAACATCAAAGAGCTGATTAACATTTATGGGAATCCAACACAAATAACC
CTGATTTTCATTCGAGTACCTCGCACAAAACAACTTGTGAATCAAGCATCAACTGCATTCTTTGAATGGTCACTCAAGTTTGXTCTTCTT
CACTTCATGATCCTTCATAGCAGCCGTAATTGCACCGTCAAGCATCCTGCAATACGGCAATCGAACAGATGGACGATGGAAAAATGGTTT
CCTATCTTCTCCAACTATATTTACGATTTTCCCCGTCTTTCTATCGATTATCGTCTTCGCATTAGGATTATATGCGACAAGACTAATACA
GGGAACACCACCCTTAAAATAATCTTCCATCCATTTCCTCATCTTATCACTGATTTCGATTTTGATTTGAGGTTTCATCATATCCTCACA
AACCGGAGCTCCGACGACATCCTCACCAACATCCCXGATGATCATTGTAATAATATAGCTGCCGCCACCGCCAAAGGTTCACCTGGATAC
ACCGGAAACTCGATTTACGATTTGTTTCAACATCTTTTT
Edits in Original Sequence 
(5')TCGGATTCGACAACGTTCGTCAAGTCCAGTGCATCAGCTTCATTGCCTACGGGCCAGAAGGATTCTAAATTTACAAATTTTCTTTT
TGTACATTCAAGAGTTTCTCATTCTACTTCTATAATGGCTACTTCTACCATGGCTCTTTCTTCCTCTACATTTGCCGGAAAGGCGGTTAA
ACTCTCCCCATCTTCTTCTGAAATCACCGGAAATGGGAGAGTCACCATGAGGAAGACTGCTACCAAGGCCAAGCCAGCCTCCTCTGGTAG
CCCATGGTATGGTCCTGACCGTGTTAAGTACTTGGGACCATTCTCTGGGGAATCCCCAAGCTACTTGACCGGTGAGTTTCCTGGTGATTA
CGGATGGGACACTGCTGGACTTTCAGCTGACCCTGAAACATTCGCTAAGAACCGTGAGTTGGAGGTTATTCATTGTAGATGGGCCATGCT
TGGTGCTCTTGGATGTGTATTCCCCGAGCTTTTGGCCCGTAATGGTGTTAAGTTCGGTGAAGCTGTATGGTTCAAGGCTGGATCACAAAT
TTTCAGCGAGGGTGGACTTGACTACTTGGGAAACCCAAGCTTGGTCCATGCACAAAGCATTTTGGCTATCTGGGCTTGCCAAGTTGTGTT
GATGGGAGCCGTTGAGGGTTACCGTATTGCTGGTGGGCCTCTTGGTGAGGTTGTTGACCCACTCTACCCTGGTGGTAGCTTTGACCCACT
GGGCCTTGCTGATGACCCAGAGGCTTTTGCTGAGCTCAAGGTAAAAGAGATCAAGAATGGTAGACTTGCTATGTTCTCCATGTTCGGATT
CTTTGTTCAAGCTATCGTCACCGGAAAGGGTCCATTGGAGAACCTTGCTGACCATCTCGCTGATCCAGTCAATAACAATGCTTGGGCCTT
CGCCACAAACTTTGTCCCCgGAAAGTGAAGTTTTTAAAAAATTAGTTGTTXTGCTAATTGTAAATTACAAGAACATAATAATATATATGA
GTATTGTTATTGGATGCATTAAAGAGCTGTTTGCAAGAGATTATTCATCTATAAATGTGTTGTTATCCATAAATAACAACGCATTGAATT
ACCCAATCAATAAAXCTGTAAtATGTTCACATAATTTACTATACACCAAACATCAAAGAGCTGATTAACATTTATGGGAATCCAACACAA
ATAACCCTGATTTTCATTCGAGTACCTCGCACAAAACAACTTGTGAATCAAGCATCAACTGCATTCTTTGAATGGTCACTCAAGTTTGXT
CTTCTTCACTTCATGATCCTTCATAGCAGCCGTAATTGCACCGTCAAGCATCCTGCAATACGGCAATCGAACAGATGGACGATGGAAAAA
TGGTTTCCTATCTTCTCCAACTATATTTACGATTTTCCCCGTCTTTCTATCGATTATCGTCTTCGCATTAGGATTATATGCGACAAGACT
AATACAGGGAACACCACCCTTAAAATAATCTTCCATCCATTTCCTCATCTTATCACTGATTTCGATTTTGATTTGAGGTTTCATCATATC
CTCACAAACCGGAGCTCCGACGACATCCTCACCAACATCCCXGATGATCATTGTAATAATATAGCTGCCGCCACCGCCAAAGGTTCACCg
TGGATACACCGGAAACTCGATTTACGATTTGTTTCAACATCTTTTT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan