ESTScan Details for Unigene SGN-U579194

Score 
979
Direction 
Forward
Predicted Peptide Sequence 
MGQGLSCGTSDEHGLFSAVQCGDLDTLKSVLDKNPSLIHHSTVYDRQSPLHIAAANGQIEIVTMLLNKSINPDLLNRYKQTPLMLAAMHG
KISCVEKLIEAGANILKFDSLNGRTCLHYAAYYGHFESLKAILSTARTSHVAASWGYARFVNVRDGKGATPLHLAARQRRPECVHILLDN
GALVCASTGGYGFPGSTPLHLAARGGSLDCIRELLAWGADRLHRDSTGRIPYTVALRYHHGACAALLNPSSAEPLVWPSPLKFISQLNDE
AKALLERALMEANKEREKNILKGTDYSPPSPSQSDAGMDDNMSEVSDRKYVASVLINYAQLKSRTVGTRCVHIVYWPYAATTSQTRPXTS
PPEPVCPFCRSNIVQLQAIKVTKNNDTDSDLHSSKLRKTRRSRNFSEGSSSFKGLSAVSSFGKMTGRGSGRIAADNEWIDKPITLD*
Predicted Coding Sequence 
ATGGGTCAGGGACTGAGTTGTGGAACGAGTGATGAACATGGTTTATTCAGTGCTGTTCAGTGTGGTGATTTAGACACATTAAAATCTGTT
TTAGACAAAAACCCATCTCTTATTCATCATTCTACTGTATATGATCGACAATCTCCTCTTCATATTGCTGCTGCCAATGGCCAGATCGAG
ATTGTTACTATGCTGTTAAACAAATCTATCAACCCAGATTTGTTGAATCGCTATAAACAGACTCCATTGATGTTAGCAGCAATGCATGGG
AAGATCTCTTGTGTGGAAAAGCTAATTGAAGCAGGAGCTAATATTTTGAAGTTTGATTCACTTAATGGAAGAACATGTTTGCACTATGCT
GCATACTATGGACATTTTGAATCACTTAAAGCTATTCTATCCACAGCTCGTACATCTCATGTTGCAGCATCTTGGGGATATGCAAGGTTT
GTGAATGTTAGAGATGGTAAAGGAGCAACACCTTTGCATTTAGCAGCCCGTCAAAGACGGCCTGAATGTGTTCACATTTTGCTCGACAAT
GGCGCTCTGGTCTGCGCATCAACCGGTGGATATGGATTTCCTGGTAGTACTCCGCTTCATTTGGCTGCAAGAGGTGGTTCTCTTGATTGC
ATCCGTGAATTGTTGGCGTGGGGAGCAGATCGATTACATAGAGATTCCACCGGGAGAATACCATACACGGTTGCTTTAAGGTACCACCAT
GGTGCTTGTGCAGCTTTGTTGAATCCTTCATCGGCAGAGCCTCTCGTGTGGCCATCGCCGTTGAAGTTCATTAGTCAGCTCAATGATGAG
GCGAAAGCCTTGCTAGAACGTGCGTTAATGGAAGCGAATAAGGAGAGGGAAAAAAATATCTTAAAGGGTACAGATTACTCTCCACCTTCC
CCATCACAATCTGATGCAGGGATGGATGACAACATGTCTGAGGTCAGTGATAGGAAGTATGTTGCATCTGTTTTGATCAATTATGCACAA
TTGAAGTCCAGGACTGTGGGCACCAGATGTGTGCACATTGTGTACTGGCCTTATGCTGCCACAACAAGCCAAACCCGACCACXGACTAGT
CCACCAGAACCCGTGTGCCCATTCTGCAGAAGCAACATTGTACAGTTACAAGCTATCAAGGTCACAAAGAACAATGACACAGATTCTGAT
CTCCACTCCTCAAAACTTCGAAAGACTAGGAGATCACGAAACTTCAGCGAGGGCAGCAGTAGTTTCAAGGGGTTATCAGCAGTAAGTTCT
TTTGGCAAAATGACTGGTCGTGGCTCCGGTAGGATTGCTGCTGATAACGAATGGATCGATAAGCCAATAACCCTTGATTGA
Edits in Original Sequence 
CGCAAACATGCTTTTACTTGATTCCATGGAACTTCGCAAAATACAGATTCACAGTATCTTATCAACCAAATATAAGAGCAAATAACTTAA
AACCACCCTTAAACCAGTATGGATATTAAAACTAATCTATAAAGGCCATAAAACATAGGCCTAATTAAGAGCTATCAATCTAATAACTCT
TACACTTATCTCCACCACCACTCTCCACCACCTCCGCCGCCGCCGTTCACGGTGGTGCAAAAAAGTTCCCTTTTTTTCTCTCTCGAAAA
(5')ATGGGTCAGGGACTGAGTTGTGGAACGAGTGATGAACATGGTTTATTCAGTGCTGTTCAGTGTGGTGATTTAGACACATTAAAATCT
GTTTTAGACAAAAACCCATCTCTTATTCATCATTCTACTGTATATGATCGACAATCTCCTCTTCATATTGCTGCTGCCAATGGCCAGATC
GAGATTGTTACTATGCTGTTAAACAAATCTATCAACCCAGATTTGTTGAATCGCTATAAACAGACTCCATTGATGTTAGCAGCAATGCAT
GGGAAGATCTCTTGTGTGGAAAAGCTAATTGAAGCAGGAGCTAATATTTTGAAGTTTGATTCACTTAATGGAAGAACATGTTTGCACTAT
GCTGCATACTATGGACATTTTGAATCACTTAAAGCTATTCTATCCACAGCTCGTACATCTCATGTTGCAGCATCTTGGGGATATGCAAGG
TTTGTGAATGTTAGAGATGGTAAAGGAGCAACACCTTTGCATTTAGCAGCCCGTCAAAGACGGCCTGAATGTGTTCACATTTTGCTCGAC
AATGGCGCTCTGGTCTGCGCATCAACCGGTGGATATGGATTTCCTGGTAGTACTCCGCTTCATTTGGCTGCAAGAGGTGGTTCTCTTGAT
TGCATCCGTGAATTGTTGGCGTGGGGAGCAGATCGATTACATAGAGATTCCACCGGGAGAATACCATACACGGTTGCTTTAAGGTACCAC
CATGGTGCTTGTGCAGCTTTGTTGAATCCTTCATCGGCAGAGCCTCTCGTGTGGCCATCGCCGTTGAAGTTCATTAGTCAGCTCAATGAT
GAGGCGAAAGCCTTGCTAGAACGTGCGTTAATGGAAGCGAATAAGGAGAGGGAAAAAAATATCTTAAAGGGTACAGATTACTCTCCACCT
TCCCCATCACAATCTGATGCAGGGATGGATGACAACATGTCTGAGGTCAGTGATAcGGAAGTATGTTGCATCTGTTTTGATCAATTATGC
ACAATTGAAGTCCAGGACTGTGGGCACCAGATGTGTGCACATTGTGTACTGGCCTTATGCTGCCACAACAAGCCAAACCCGACCACXGAC
TAGTCCACCAGAACCCGTGTGCCCATTCTGCAGAAGCAACATTGTACAGTTACAAGCTATCAAGGTCACAAAGAACAATGACACAGATTC
TGATCTCCACTCCTCAAAACTTCGAAAGACTAGGAGATCACGAAACTTCAGCGAGGGCAGCAGTAGTTTCAAGGGGTTATCAGCAGTAAG
TTCTTTTGGCAAAATGACTGGTCGTGGCTCCGGTAGGATTGCTGCTGATAACGAATGGATCGATAAGCCAATAACCCTTGATTGA(3')T
ACCTCAAAAAAGTTTCCAACTTTGGCACTTAAAGAAACAATTCCAGGGTGGGTGGGGTCTTGCTTCTCAAATGGTATATATAGTTAGATA
GATTTCTCCTTCTCTTCCCTATGTTTTGTAGATTTGGGAAATAAGCAAAGTTGAAATGATTTGCAAGCTTGGTTTAGATTGAGTACTATA
TCATTTGTGTGGGTCACAAAAAAGAAAAGAAAAGAGTATTTGTGTAAAATCTTGTTTTCTTGATGTAGTAGACAAAATTCTTTGAAGTTT
TTTACCCCCTTTTTTTTCCTAGTTTTTTGTGTTTTTCACTTTTTAGGTGAAAACACTAACATTCTTCCATTATAGTATTGATGAAGTTAG
CATTGGGGAAGAGTCAAAATGAAAGCAAGTGATGAGGAAAGTAGACCCTACCTTACCCTATATGTTTTCTTTAAATTAAAGTAGCACCAA
GGTGTGAAATGAACTACAATTTGTATCAATTATTTTATTGAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan