ESTScan Details for Unigene SGN-U579217

Score 
1418
Direction 
Forward
Predicted Peptide Sequence 
MEEGTLEVGMEYRTVSGVAGPLVILEKVKGPKYQEIVNIRLGDGTTRRGQVLEVDGEKAVVQVFEGTSGIDNKYTTVQFTGEVLKTPVSL
DMLGRIFNGSGKPIDNGPPILPEAYRDISGSSINPSERTYPEEMIQTGISTIDVMNSIARGQKIPLFSAAGLPHNEIAAQICRQAGLVKR
LEKSENLLEDSEADNFAIVFAAMGVNMETAQFFKRDFEENGSMERVTLFLNLANDPTIERIITPRIALTTAEYLAYECGKHVLVILTDMS
SYADALREVSAAREEVPGRRGYPGYMYTDLATIYERAGRIEGRTGSITQIPILTMPNDDITHPTPDLTGYITEGQIYIDRQLHNRQIYPP
INVLPSLSRLMKSAIGEGMTRRDHADVSNQLYANYAIGKDVQAMKAVVGEEALSSEDLLYLEFLDKFERKFVSQGAYDTRNIFQSLDLAW
TLLRIFPRELLHRIPAKTLDQYYSRDAPN*
Predicted Coding Sequence 
ATGGAGGAAGGAACCCTGGAGGTTGGAATGGAATACAGGACTGTCTCTGGTGTTGCTGGACCACTGGTTATCCTTGAAAAAGTTAAGGGA
CCTAAGTACCAGGAGATTGTTAATATTCGTTTGGGAGATGGAACAACCCGACGTGGACAAGTTCTGGAAGTTGATGGGGAAAAAGCTGTC
GTTCAGGTTTTTGAAGGAACATCTGGAATTGACAACAAATACACAACTGTGCAGTTTACTGGGGAGGTTTTGAAGACACCTGTCTCACTC
GATATGCTTGGACGCATATTTAATGGTTCTGGAAAGCCAATTGACAATGGTCCTCCTATTTTACCTGAGGCTTACAGGGATATTTCTGGA
AGTTCTATCAACCCCAGTGAGAGAACATATCCTGAAGAGATGATACAGACAGGAATTTCAACAATTGACGTCATGAATTCAATTGCTAGA
GGGCAGAAAATTCCTCTATTCTCTGCTGCTGGTCTTCCTCATAATGAAATTGCGGCTCAGATCTGCCGACAAGCTGGTTTAGTGAAGAGG
TTGGAGAAATCTGAAAATCTTCTTGAGGACAGTGAAGCGGACAATTTTGCCATAGTCTTTGCAGCTATGGGAGTCAACATGGAAACCGCA
CAATTTTTCAAACGCGATTTTGAGGAAAATGGATCCATGGAGAGAGTGACGCTTTTCTTAAATCTGGCAAATGATCCTACAATAGAACGC
ATCATTACTCCCAGGATTGCTCTGACCACTGCAGAATATCTAGCATACGAATGTGGGAAGCATGTTCTTGTCATTTTAACTGATATGAGT
TCATATGCTGATGCTCTGCGTGAGGTATCTGCTGCCCGAGAAGAAGTGCCTGGAAGGCGTGGATATCCTGGTTATATGTATACTGATCTG
GCAACGATCTATGAACGAGCTGGGCGTATTGAGGGACGGACGGGTTCCATCACGCAAATTCCAATTCTAACCATGCCAAATGATGATATT
ACGCATCCAACTCCAGATCTTACAGGCTATATCACAGAAGGACAAATATATATAGACCGACAGCTTCATAACCGACAGATATATCCTCCA
ATCAATGTACTTCCATCCTTATCTCGGCTGATGAAGAGTGCCATTGGTGAGGGTATGACTAGAAGGGATCATGCTGATGTATCCAACCAG
TTATATGCAAATTATGCCATTGGAAAAGATGTCCAGGCAATGAAAGCTGTGGTTGGAGAAGAAGCACTTTCTTCTGAGGACTTGCTTTAC
TTAGAGTTCCTTGACAAATTTGAGAGGAAGTTTGTCTCTCAAGGAGCTTATGACACCCGCAATATATTCCAGTCACTTGATTTAGCTTGG
ACACTTCTTCGCATCTTTCCCCGTGAGCTTTTGCATCGTATCCCAGCAAAGACCCTGGATCAGTATTACAGCCGCGATGCACCTAATTGA
Edits in Original Sequence 
TTAGCTATACCTTTTTTTATTTTTCAAGTGGTAACTCAATCAGCCCCCTTGGATCTCTCTTTCACTAGCGTGGCATCACGTTGATTCCGG
TTTTTATTCTCTCTCCGGTCCATCTACTTTTTTCTCCTCTGTATTTCAGAAGAAAAGGTTAACTATGGGTAAGGCAAAAAAAAATATTGA
AAAC
(5')ATGGAGGAAGGAACCCTGGAGGTTGGAATGGAATACAGGACTGTCTCTGGTGTTGCTGGACCACTGGTTATCCTTGAAAAAG
TTAAGGGACCTAAGTACCAGGAGATTGTTAATATTCGTTTGGGAGATGGAACAACCCGACGTGGACAAGTTCTGGAAGTTGATGGGGAAA
AAGCTGTCGTTCAGGTTTTTGAAGGAACATCTGGAATTGACAACAAATACACAACTGTGCAGTTTACTGGGGAGGTTTTGAAGACACCTG
TCTCACTCGATATGCTTGGACGCATATTTAATGGTTCTGGAAAGCCAATTGACAATGGTCCTCCTATTTTACCTGAGGCTTACAGGGATA
TTTCTGGAAGTTCTATCAACCCCAGTGAGAGAACATATCCTGAAGAGATGATACAGACAGGAATTTCAACAATTGACGTCATGAATTCAA
TTGCTAGAGGGCAGAAAATTCCTCTATTCTCTGCTGCTGGTCTTCCTCATAATGAAATTGCGGCTCAGATCTGCCGACAAGCTGGTTTAG
TGAAGAGGTTGGAGAAATCTGAAAATCTTCTTGAGGACAGTGAAGCGGACAATTTTGCCATAGTCTTTGCAGCTATGGGAGTCAACATGG
AAACCGCACAATTTTTCAAACGCGATTTTGAGGAAAATGGATCCATGGAGAGAGTGACGCTTTTCTTAAATCTGGCAAATGATCCTACAA
TAGAACGCATCATTACTCCCAGGATTGCTCTGACCACTGCAGAATATCTAGCATACGAATGTGGGAAGCATGTTCTTGTCATTTTAACTG
ATATGAGTTCATATGCTGATGCTCTGCGTGAGGTATCTGCTGCCCGAGAAGAAGTGCCTGGAAGGCGTGGATATCCTGGTTATATGTATA
CTGATCTGGCAACGATCTATGAACGAGCTGGGCGTATTGAGGGACGGACGGGTTCCATCACGCAAATTCCAATTCTAACCATGCCAAATG
ATGATATTACGCATCCAACTCCAGATCTTACAGGCTATATCACAGAAGGACAAATATATATAGACCGACAGCTTCATAACCGACAGATAT
ATCCTCCAATCAATGTACTTCCATCCTTATCTCGGCTGATGAAGAGTGCCATTGGTGAGGGTATGACTAGAAGGGATCATGCTGATGTAT
CCAACCAGTTATATGCAAATTATGCCATTGGAAAAGATGTCCAGGCAATGAAAGCTGTGGTTGGAGAAGAAGCACTTTCTTCTGAGGACT
TGCTTTACTTAGAGTTCCTTGACAAATTTGAGAGGAAGTTTGTCTCTCAAGGAGCTTATGACACCCGCAATATATTCCAGTCACTTGATT
TAGCTTGGACACTTCTTCGCATCTTTCCCCGTGAGCTTTTGCATCGTATCCCAGCAAAGACCCTGGATCAGTATTACAGCCGCGATGCAC
CTAATTGA(3')CAGGAAGGAACCATCTTTATACTTTCAAGTCTCTTGTGCAATTCCTTGGTGCAATACATTGGCTTTCCTCTTTGTGCA
TCTCCTTTTAGCTCAACAATCAACGAGTTCCCAAAACAAAGGTTCTCCAGTTTCTAAAAGTCAATGCTATTTCTTTGGGAACCAGTCACA
TCTTGTAATTTATCACCTGTTGTGTTGTGTGAGATGCTGCAGCGTATATTGGTTTTGTTTAAATTCCAATAACATTATAGGGGGCTTCTA
GGTTTTATGCTCAGCCGTTTTTATGTATGAAGCAATTTTATTGTTTTTCATGGACTAAAAGCTGATTCTTTTGAATAAAAGATCTTGGTA
TCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAATGTTGGAGGGGACCCAGGAAGACCTTCCCCCACTTTGGACTCA
AAAAAAATCATACACCTCTAATCATTAAAAAAACGAATGAAGGAGAGAAATATCTCAAAACAAATGTTGAGCCTGATCACATTGCATCAT
GGGTTAAGGAGTTCAAGGATGGCAAGGTGAAACCTTACAAAAAATCAGAACCTATCCCAGAGGTCAACAACGAACCTGTTAAAGTTGTGG
TTGCTGACAATTTCCAGGATATGGTTTTCAACTCTGGGAAGAATGTACTCATCGAGTTCTATGCCCCTTGGTGTGGACACTGTAAGCAGT
TGGCCCCAATCCTTGATGAAGTGGCTGTCTCATTTGAAAGTGATGCAGATGTTATGATTGCCAAAATTGATGCTACTGCTAATGATTATT
CACAGGGAACTTTTGAGGTCAAAGGTTATCCTACTCTTTATTTCAAGTCAGCAAGTGGAAAGCTTTTGCAGCATCAAGGTGGGAGGACCA
AGGAAGACATTATTGACTTTATCCAGAAGAATCGGGATAAAGCTGCAGAGCAAAGTCCGGGAAAAGATGAGCTATAATTTAAGGAAGAAA
ATGTCTAATGCAGTTGGCGTTGGCTGCCTTACTGATTTACAACCTCCAGGCAAGTGAGAAGAAAGAAACAAGAGCACAAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan