ESTScan Details for Unigene SGN-U579250

Score 
1303
Direction 
Forward
Predicted Peptide Sequence 
MEASAGVLRRFPSVTGAGVGVSSNPLNRSCSVSRVSLKSMGCGFYDEGCLEYYSSGRGGIIRCGKKKNKEKDMAELKKTKKKMKLLKGLT
KNLSNLNGMGLGFGCDVDLVDQVQGKTISEAAELLLGQLQQLKAEEKELKRKRKEEKAQMKMKVAASEVQSNTRSCAMSSSSSSSSESSD
SSDDECQNLVDMKSLKIGTLAQTIPEACDRALDNATLNPSLSTPEVDTTVEISSMPSTTTEESTGKTTSFEFSVPEQKGECCLEASDCHI
GNVGSSITPGTRSNVSSIAAATTTTAEGTKRIEVCMGGKCKRLGAGALLEEFQRVAGIEAAVSGCKCMGKCKVGPNVKVSGCSSSSISDA
FQAGDSVAVSSAPTTSNSLCIGVGLEDVSLIAANLLGRYQEEAWPMLCLKSFFLSLAXIVGRFFWDFGNEFESFFXNVNISNIEKFAIYV
NIIIIYRYGPFVSLKYPDLDEEYREVMRDFAKRLEKLAEELLDLLCKNLGLEKSYLKNAFYGSECPDFGTKVSNYPPCPNPDLIKGLRAH
TDAGGIILLFQYDKVSGLSLLIDEQWIDVPPMRHSIV
Predicted Coding Sequence 
ATGGAAGCCTCTGCCGGAGTTTTACGCCGATTTCCTTCAGTCACCGGCGCCGGTGTCGGAGTTAGCAGCAATCCGTTGAATCGTAGTTGT
AGTGTTTCACGTGTTAGTTTGAAATCAATGGGTTGTGGGTTTTACGATGAGGGTTGTTTGGAGTATTATTCATCTGGTAGAGGTGGAATT
ATTAGGTGTGGGAAGAAGAAGAACAAAGAGAAGGATATGGCGGAGTTGAAGAAAACGAAGAAGAAGATGAAATTACTTAAGGGTTTGACG
AAGAATTTGTCGAATTTGAATGGGATGGGATTAGGGTTCGGTTGTGATGTTGATTTGGTTGATCAAGTTCAAGGGAAGACAATTTCGGAG
GCGGCGGAGCTATTGTTGGGACAGCTTCAACAGTTGAAGGCAGAGGAGAAGGAGTTGAAGAGGAAAAGAAAAGAAGAAAAAGCACAAATG
AAGATGAAAGTAGCAGCAAGTGAAGTGCAGAGCAACACAAGGAGCTGTGCAATGTCATCATCTTCAAGCTCGTCTTCAGAATCGAGTGAT
TCAAGTGATGATGAATGTCAAAATTTGGTTGACATGAAAAGCCTGAAAATCGGAACACTTGCTCAAACAATTCCTGAAGCGTGTGATCGA
GCACTTGATAATGCAACACTAAACCCTTCCCTTTCAACTCCAGAAGTCGATACAACAGTAGAGATCTCAAGCATGCCATCAACTACCACG
GAGGAATCAACTGGGAAGACGACAAGTTTTGAGTTTTCAGTCCCTGAACAAAAAGGCGAATGCTGCTTGGAAGCTAGTGATTGTCACATT
GGCAATGTAGGCAGCAGTATCACACCAGGCACTAGGTCTAATGTATCATCTATAGCAGCAGCTACAACGACAACAGCAGAGGGTACAAAG
AGAATCGAAGTATGTATGGGTGGTAAATGCAAGCGATTGGGCGCTGGAGCGTTACTAGAAGAATTCCAACGCGTTGCTGGGATTGAAGCT
GCAGTCTCTGGTTGCAAATGCATGGGAAAGTGTAAAGTTGGTCCTAATGTCAAAGTTTCAGGGTGTAGCAGCAGCAGCATCTCGGACGCC
TTCCAAGCCGGTGACTCGGTTGCTGTTAGCTCTGCTCCAACTACAAGTAACTCTCTATGTATTGGGGTTGGTTTAGAGGATGTGAGTCTA
ATTGCAGCCAATTTACTTGGCAGATATCAAGAAGAGGCTTGGCCAATGCTTTGCCTTAAATCTTTTTTTCTTTCATTAGCAATXATAGTA
GGTAGGTTTTTTTGGGATTTTGGCAATGAGTTTGAATCTTTTTTTGXTAATGTAAATATCAGCAATATAGAAAAGTTTGCTATTTATGTG
AATATTATCATTATATACAGATATGGACCTTTTGTATCTCTCAAGTACCCXGATCTTGACGAAGAATACAGAGAGGTGATGAGAGATTTT
GCTAAAAGATTGGAGAAATTGGCTGAGGAGTTACTTGACTTACTCTGTAAAAATCTTGGACTTGAAAAAAGTTACTTGAAAAATGCCTTT
TATGGATCAGAATGTCCCGACTTTGGTACTAAAGTTAGCAACTATCCACCATGTCCTAATCCCGATTTGATCAAGGGACTCCGCGCTCAT
ACAGACGCAGGAGGCATCATACTTCTGTTCCAATATGACAAAGTGAGTGGCCTTTCACTCCTCATAGACGAACAATGGATCGATGTTCCT
CCCATGCGCCACTCTATTGTX
Edits in Original Sequence 
AAATTCTTGTTCAGTGTAAAGTTGAACAAGAATTTGATCATCCATA(5')ATGGAAGCCTCTGCCGGAGTTTTACGCCGATTTCCTTCAG
TCACCGGCGCCGGTGTCGGAGTTAGCAGCAATCCGTTGAATCGTAGTTGTAGTGTTTCACGTGTTAGTTTGAAATCAATGGGTTGTGGGT
TTTACGATGAGGGTTGTTTGGAGTATTATTCATCTGGTAGAGGTGGAATTATTAGGTGTGGGAAGAAGAAGAACAAAGAGAAGGATATGG
CGGAGTTGAAGAAAACGAAGAAGAAGATGAAATTACTTAAGGGTTTGACGAAGAATTTGTCGAATTTGAATGGGATGGGATTAGGGTTCG
GTTGTGATGTTGATTTGGTTGATCAAGTTCAAGGGAAGACAATTTCGGAGGCGGCGGAGCTATTGTTGGGACAGCTTCAACAGTTGAAGG
CAGAGGAGAAGGAGTTGAAGAGGAAAAGAAAAGAAGAAAAAGCACAAATGAAGATGAAAGTAGCAGCAAGTGAAGTGCAGAGCAACACAA
GGAGCTGTGCAATGTCATCATCTTCAAGCTCGTCTTCAGAATCGAGTGATTCAAGTGATGATGAATGTCAAAATTTGGTTGACATGAAAA
GCCTGAAAATCGGAACACTTGCTCAAACAATTCCTGAAGCGTGTGATCGAGCACTTGATAATGCAACACTAAACCCTTCCCTTTCAACTC
CAGAAGTCGATACAACAGTAGAGATCTCAAGCATGCCATCAACTACCACGGAGGAATCAACTGGGAAGACGACAAGTTTTGAGTTTTCAG
TCCCTGAACAAAAAGGCGAATGCTGCTTGGAAGCTAGTGATTGTCACATTGGCAATGTAGGCAGCAGTATCACACCAGGCACTAGGTCTA
ATGTATCATCTATAGCAGCAGCTACAACGACAACAGCAGAGGGTACAAAGAGAATCGAAGTATGTATGGGTGGTAAATGCAAGCGATTGG
GCGCTGGAGCGTTACTAGAAGAATTCCAACGCGTTGCTGGGATTGAAGCTGCAGTCTCTGGTTGCAAATGCATGGGAAAGTGTAAAGTTG
GTCCTAATGTCAAAGTTTCAGGGTGTAGCAGCAGCAGCATCTCGGACGCCTTCCAAGCCGGTGACTCGGTTGCTGTTAGCTCTGCTCCAA
CTACAAGTAACTCTCTATGTATTGGGGTTGGTTTAGAGGATGTGAGTCTAATTGCAGCCAATTTACTTGGCAGATATCAAGAAGtAGGCT
TGGCCAATGCTTTGCCTTAAATCTTTTTTTCTTTCATTAGCAATXATAGTAGGTAGGTTTTTTTGGGATTTTGGCAATGAGTTTGAATCT
TTTTTTGXTAATGTAAATATCAGCAATATAGAtAAAGTTTGCTATTTATGTGAATATTATCATTATATACAGATATGGACCTTTTGTATC
TCTCAAGTACCCXGATCTTGACGAAGAATACAGAGAGGTGATGAGAGATTTTGCTAAAAGATTGGAGAAATTGGCTGAGGAGTTACTTGA
CTTACTCTGTAAAAATCTTGGACTTGAAAAAAGTTACTTGAAAAATGCCTTTTATGGATCAGAATGTCCCGACTTTGGTACTAAAGTTAG
CAACTATCCACCATGTCCTAATCCCGATTTGATCAAGGGACTCCGCGCTCATACAGACGCAGGAGGCATCATACTTCTGTTCCAATATGA
CAAAGTGAGTGGCCTTTCACTCCTCATAGACGAACAATGGATCGATGTTCCTCCCATGCGCCACTCTATTGTX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan