ESTScan Details for Unigene SGN-U579429

Score 
2163
Direction 
Forward
Predicted Peptide Sequence 
MASISATLSTATLPELKFLSPISTSRSFRFRIPQRSRIKAASGKREDNVVLEERDAELLRKVNGSVNGNGSVKRSVDLNGALLVDKYSNG
SVGVIESENGSLMKYVNGNGVAGKSAEKVVEVKAEEVVEKRNKKSIDEIGQEEAWFKKNKEVKVSVPPGGRWNRFKTYSTIQRTLEIWGS
VFTFLFKAWLNNQKFSYQGGMTEAKKTERRKVLAKWLKETILRLGPTFIKIGQQFSTRVDILAQEYVDQLSELQDQVPPFPSETAVSIVE
EELGGSLDNIFERFDREPIAAASLGQVHRARLNGQEVVVKVQRPGLKDLFDIDLKNLRVIAEYLQKIDPKSDGAKRDWVAIYDECASVLY
QEIDYTKEAANAELFASNFKNLDYVKVPSIYWEYTTPQVLTMEYVPGIKINRIQALDQLGVDRKRLGRYAVESYLEQILSHGFFHADPHP
GNIAVDDVNGGRLIFYDFGMMGSISPNIREGLLETFYGVYEKDPDKVLQASIQMGILVPTGDMTAVRRTAQFFLNSFEERLAAQRKEREM
AQAELGFKKPLTKEELKEKKKQRLAAIGEDLLAIAADQPFRFPATFTFVVRAFSVLDGIGKGLDPRFDITEIAKPYALELLRFREAGIEV
AVKDFRKRWDRQSQAFYNLFRQADRVEKLAAIIQRLEQGDLKLRVRALESERAFQRVAAVQKTIGSGVAAGSLVNLATILYLNSVRIPSI
IAYTACAFFGFQVLFGLLKVKKLDEXRKIDYWNSLNKWNSLNKCTGYAVNNIWELLFQAVTLEKTKITWRGLNGSLRIHSTPMAKSCQFC
HSALDASCGKASNMEFNF*
Predicted Coding Sequence 
ATGGCGAGTATTTCAGCTACACTTTCAACTGCAACTTTACCGGAACTCAAATTTCTATCTCCGATTTCCACTTCCAGAAGTTTCCGTTTC
CGTATACCTCAGCGGAGTAGAATTAAGGCGGCGTCGGGTAAGAGAGAAGATAACGTGGTGTTGGAGGAGAGAGATGCGGAATTGTTGAGG
AAAGTGAATGGGAGTGTGAATGGGAATGGGAGTGTGAAGAGGAGTGTTGATTTGAATGGTGCGTTGTTGGTGGATAAGTATAGTAATGGA
AGTGTAGGTGTGATTGAGAGTGAAAATGGAAGTTTGATGAAGTATGTGAATGGAAATGGTGTAGCGGGGAAGAGTGCGGAGAAGGTTGTG
GAGGTGAAGGCAGAAGAAGTGGTTGAGAAGAGGAATAAGAAGAGTATTGATGAGATAGGACAAGAGGAGGCTTGGTTTAAGAAGAATAAG
GAAGTTAAGGTCTCTGTACCGCCTGGAGGCCGTTGGAACAGATTCAAAACATATTCAACTATTCAAAGGACTTTAGAGATATGGGGATCT
GTCTTCACTTTCTTATTCAAGGCTTGGTTGAATAATCAAAAGTTCTCCTATCAAGGTGGAATGACAGAAGCAAAAAAAACTGAGCGGAGA
AAGGTCCTTGCTAAGTGGTTAAAAGAAACTATTTTGAGATTGGGTCCAACTTTTATCAAGATTGGCCAGCAATTCTCAACAAGAGTGGAT
ATTCTTGCTCAGGAGTATGTTGATCAGTTGTCTGAGCTTCAGGACCAAGTTCCTCCTTTCCCATCTGAAACTGCTGTATCCATAGTTGAA
GAAGAACTTGGCGGCTCATTGGATAATATATTTGAAAGATTTGACCGTGAACCAATAGCTGCTGCAAGTCTTGGTCAGGTGCATCGTGCA
AGACTGAATGGGCAGGAAGTAGTTGTCAAAGTACAAAGGCCCGGTCTTAAGGATCTTTTTGATATCGATCTTAAAAACCTGAGGGTGATA
GCTGAATATCTGCAGAAAATAGATCCTAAATCTGACGGTGCGAAAAGAGATTGGGTTGCAATCTATGATGAATGTGCAAGTGTCTTGTAT
CAGGAGATTGATTACACTAAGGAAGCTGCCAATGCGGAACTGTTTGCAAGTAACTTCAAAAACCTAGATTATGTGAAAGTCCCATCGATA
TACTGGGAATATACCACACCACAGGTTTTGACAATGGAGTATGTCCCAGGCATTAAAATAAACAGGATTCAAGCCTTAGATCAATTGGGC
GTTGATAGGAAAAGGTTAGGGCGGTATGCGGTTGAATCCTATCTGGAGCAAATTCTGTCTCATGGTTTCTTTCATGCTGATCCACATCCT
GGAAATATAGCTGTGGATGATGTTAATGGTGGAAGGTTGATCTTTTATGATTTTGGAATGATGGGAAGCATAAGTCCTAATATCAGAGAA
GGCTTGCTGGAAACGTTCTATGGAGTTTATGAGAAAGATCCAGATAAGGTCCTGCAAGCAAGTATTCAAATGGGTATTCTGGTTCCTACT
GGCGACATGACTGCTGTCAGACGAACTGCACAGTTTTTCCTTAATAGCTTTGAAGAGCGCCTTGCAGCACAAAGAAAGGAGAGAGAAATG
GCACAAGCAGAACTTGGGTTCAAAAAGCCATTGACCAAGGAGGAACTAAAGGAGAAAAAGAAGCAACGTTTGGCTGCAATTGGTGAAGAT
CTACTAGCCATTGCAGCAGATCAGCCATTCCGATTTCCTGCCACATTTACTTTTGTGGTTAGAGCATTTTCAGTTTTGGATGGCATTGGG
AAGGGTCTTGATCCACGATTTGATATCACTGAGATAGCCAAACCCTATGCCCTAGAGTTGCTTAGGTTTCGTGAAGCTGGTATTGAAGTC
GCGGTAAAGGACTTCAGGAAGAGATGGGACAGACAGTCTCAGGCATTCTACAACTTGTTCAGGCAGGCTGATAGAGTTGAGAAACTTGCT
GCAATTATCCAGCGACTGGAGCAAGGTGACCTTAAGCTTCGGGTTAGAGCTTTAGAATCTGAAAGGGCTTTCCAACGTGTTGCTGCTGTT
CAGAAGACAATTGGAAGTGGAGTAGCCGCTGGAAGCTTGGTTAACCTAGCTACAATTTTGTATCTCAACTCCGTCCGTATCCCCTCTATT
ATAGCGTACACTGCCTGTGCATTCTTTGGCTTCCAAGTCCTGTTTGGCCTTCTGAAGGTTAAAAAATTAGATGAACXGAGAAAGATTGAT
TACTGGAACAGCTTGAACAAATGGAACAGCTTGAACAAATGTACAGGTTATGCTGTGAATAATATATGGGAACTGCTATTCCAAGCTGTA
ACCCTGGAAAAAACAAAAATAACATGGAGGGGACTTAACGGATCATTGAGGATTCATAGCACTCCCATGGCCAAGAGTTGCCAGTTTTGT
CATTCAGCTTTAGATGCATCATGTGGTAAGGCTTCCAATATGGAGTTTAACTTCTAA
Edits in Original Sequence 
CAGCCATTAACTTCCCCTTCTCCTTCACAAGTTCCATAAATTCTCTCTAAGCTTATGGCAACTCAGTTCTAGAATCTTCTATAACTCAAT
CTCTATATCTGCTGCTACTTCGACGAAA
(5')ATGGCGAGTATTTCAGCTACACTTTCAACTGCAACTTTACCGGAACTCAAATTTCTAT
CTCCGATTTCCACTTCCAGAAGTTTCCGTTTCCGTATACCTCAGCGGAGTAGAATTAAGGCGGCGTCGGGTAAGAGAGAAGATAACGTGG
TGTTGGAGGAGAGAGATGCGGAATTGTTGAGGAAAGTGAATGGGAGTGTGAATGGGAATGGGAGTGTGAAGAGGAGTGTTGATTTGAATG
GTGCGTTGTTGGTGGATAAGTATAGTAATGGAAGTGTAGGTGTGATTGAGAGTGAAAATGGAAGTTTGATGAAGTATGTGAATGGAAATG
GTGTAGCGGGGAAGAGTGCGGAGAAGGTTGTGGAGGTGAAGGCAGAAGAAGTGGTTGAGAAGAGGAATAAGAAGAGTATTGATGAGATAG
GACAAGAGGAGGCTTGGTTTAAGAAGAATAAGGAAGTTAAGGTCTCTGTACCGCCTGGAGGCCGTTGGAACAGATTCAAAACATATTCAA
CTATTCAAAGGACTTTAGAGATATGGGGATCTGTCTTCACTTTCTTATTCAAGGCTTGGTTGAATAATCAAAAGTTCTCCTATCAAGGTG
GAATGACAGAAGCAAAAAAAACTGAGCGGAGAAAGGTCCTTGCTAAGTGGTTAAAAGAAACTATTTTGAGATTGGGTCCAACTTTTATCA
AGATTGGCCAGCAATTCTCAACAAGAGTGGATATTCTTGCTCAGGAGTATGTTGATCAGTTGTCTGAGCTTCAGGACCAAGTTCCTCCTT
TCCCATCTGAAACTGCTGTATCCATAGTTGAAGAAGAACTTGGCGGCTCATTGGATAATATATTTGAAAGATTTGACCGTGAACCAATAG
CTGCTGCAAGTCTTGGTCAGGTGCATCGTGCAAGACTGAATGGGCAGGAAGTAGTTGTCAAAGTACAAAGGCCCGGTCTTAAGGATCTTT
TTGATATCGATCTTAAAAACCTGAGGGTGATAGCTGAATATCTGCAGAAAATAGATCCTAAATCTGACGGTGCGAAAAGAGATTGGGTTG
CAATCTATGATGAATGTGCAAGTGTCTTGTATCAGGAGATTGATTACACTAAGGAAGCTGCCAATGCGGAACTGTTTGCAAGTAACTTCA
AAAACCTAGATTATGTGAAAGTCCCATCGATATACTGGGAATATACCACACCACAGGTTTTGACAATGGAGTATGTCCCAGGCATTAAAA
TAAACAGGATTCAAGCCTTAGATCAATTGGGCGTTGATAGGAAAAGGTTAGGGCGGTATGCGGTTGAATCCTATCTGGAGCAAATTCTGT
CTCATGGTTTCTTTCATGCTGATCCACATCCTGGAAATATAGCTGTGGATGATGTTAATGGTGGAAGGTTGATCTTTTATGATTTTGGAA
TGATGGGAAGCATAAGTCCTAATATCAGAGAAGGCTTGCTGGAAACGTTCTATGGAGTTTATGAGAAAGATCCAGATAAGGTCCTGCAAG
CAAGTATTCAAATGGGTATTCTGGTTCCTACTGGCGACATGACTGCTGTCAGACGAACTGCACAGTTTTTCCTTAATAGCTTTGAAGAGC
GCCTTGCAGCACAAAGAAAGGAGAGAGAAATGGCACAAGCAGAACTTGGGTTCAAAAAGCCATTGACCAAGGAGGAACTAAAGGAGAAAA
AGAAGCAACGTTTGGCTGCAATTGGTGAAGATCTACTAGCCATTGCAGCAGATCAGCCATTCCGATTTCCTGCCACATTTACTTTTGTGG
TTAGAGCATTTTCAGTTTTGGATGGCATTGGGAAGGGTCTTGATCCACGATTTGATATCACTGAGATAGCCAAACCCTATGCCCTAGAGT
TGCTTAGGTTTCGTGAAGCTGGTATTGAAGTCGCGGTAAAGGACTTCAGGAAGAGATGGGACAGACAGTCTCAGGCATTCTACAACTTGT
TCAGGCAGGCTGATAGAGTTGAGAAACTTGCTGCAATTATCCAGCGACTGGAGCAAGGTGACCTTAAGCTTCGGGTTAGAGCTTTAGAAT
CTGAAAGGGCTTTCCAACGTGTTGCTGCTGTTCAGAAGACAATTGGAAGTGGAGTAGCCGCTGGAAGCTTGGTTAACCTAGCTACAATTT
TGTATCTCAACTCCGTCCGTATCCCCTCTATTATAGCGTACACTGCCTGTGCATTCTTTGGCTTCCAAGTCCTGTTTGGCCTTCTGAAGG
TTAAAAAATTAGATGAACXGAGAAAGATTGATTACTGGAACAGCTTGAACAAATGGAACAGCTTGAACAAATGTACAGGTTATGCTGTGA
tATAATATATGGGAACTGCTATTCCAAGCTGTAACCCTGGAAAAAACAAAAATAACATGGAGGGGACTTAACGGATCATTGAGGATTCAT
AGCACTCCCATGGCCAAGAGTTGCCAGTTTTGTCATTCAGCTTTaAGATGCATCATGTGGTAAGGCTTCCAATATGGAGTTTAACTTCTA
A(3')TTATGTTGGCCAAAACAGATTGTTGTATTTCGCCATCTCCACTATAGAGCAGTCCTGTGAAGTAGTCCAAATAAGAAATATCTTT
CATGTAGTATGACACCCATTTTGACCTTCTGTAGCCTTAGTGTATAGGTATACAAAATCTAGGAGATAAATGTAACTAATTTTAGCCCTA
TCTATCTTCAATTTTATTTGTGGAGTTCGATTCTCTTGTATTTCTGTATATTATACGATGTGAACTTCTATTTATTGTAAAATCAGTGCC
ATACGAGTTTCCTAGGGATCAAATATGTCATTGAGCTAACCCTTCTTTGTATTAGTCCTCTGTATGTGTATTGATATATCAAGTCTTCTT
AGACTATGTATATAATTTCAACTTGTTTAAAACAGTCAGTCTACTGACCTGTCCTATGCACTTTGTATGTTGAATTATTATAAAGCTGAG
GATTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan