ESTScan Details for Unigene SGN-U579435

Score 
388
Direction 
Forward
Predicted Peptide Sequence 
MAMSHTNSENTTNALRYKKKSQNASITGLPXSLEYYLVGAMRGCGGKKTALPRNINISGSKHSTRTKHGHCAYRMIITWLHLLHSLPSAA
RREPNSTGACVPTTLDDPXSGHIGTLHLLFLNLFLYPEICNPQPILQLHIRSPAKLFLDESVVKVSTTTPSGPGXVMDRKVLAIKAEDYL
CHLIHAYHLITSDVHRLSEVDFVXPQNTFNTLINEGERSSLLSRLSDLLDNLRLSLRSKQISRVLDC*
Predicted Coding Sequence 
ATGGCTATGTCTCATACAAACTCAGAAAATACCACAAATGCACTGAGGTACAAAAAGAAATCACAAAATGCAAGCATTACTGGACTACCA
XCATCTCTTGAGTATTATTTGGTGGGTGCAATGAGGGGATGTGGGGGGAAAAAAACTGCTTTACCGCGTAATATAAATATATCAGGAAGT
AAACATTCCACCCGAACAAAACATGGTCACTGTGCATACCGAATGATAATCACTTGGCTTCATCTACTTCACTCTTTGCCATCGGCAGCA
CGGAGGGAGCCTAATTCAACTGGAGCTTGTGTTCCCACAACTTTGGATGATCCAXTAAGCGGACACATCGGCACCCTTCACCTTCTCTTT
CTCAATTTGTTCCTTTATCCAGAAATATGTAATCCTCAACCCATCCTTCAACTTCATATTAGGAGCCCAGCCAAGCTTTTCCTTGATGAG
AGTGTTGTCAAAGTTTCGACCACCACACCCTCTGGTCCTGGAXATGTGATGGATCGGAAGGTTCTTGCCATCAAAGCTGAGGACTATCTC
TGCCATCTCATTCATGCTTACCATCTCATCACTTCCGATGTTCACAGGCTCTCTGAAGTGGATTTTGTTAAXCCTCAGAACACCTTCAAC
ACACTCATCAATGAAGGTGAAAGATCGAGTTTGCTTTCCCGACTTTCTGACCTGCTCGATAACCTCCGTCTCTCTCTCCGTTCGAAACAA
ATTTCTAGGGTTTTGGATTGTTGA
Edits in Original Sequence 
TTTTTTTTTTTTTTTTTATATGGAATATATTGATATGTATATACCTTTAAGGAATGGGATATATCTAAGCATACACGAGTAGACATTAAT
GAGTTTGGATCGCCTCAACTATTTCACCAGGTACTTACTACTACCTCCCACTATTACAACTTCTAGGTAGCTCTACCGATGCAGTTTTAG
GCAAGACTGGAAGAAGTCACTTAGTTATTTTGTTGTCATCGCGATTTGAACATTGAACACTGATAGTGCAACAAAGACAGTGTAATGTTA
CAGAGTCAAGGAGAAAGAAAATGATAGATCGATAGCAA
(5')ATGGCTATGTCTCATACAAACTCAGAAAATACCACAAATGCACTGAGG
TAgCAAAAAGAAATCACAAAATGCAAGCATTACTGGACTACCAXCATCTCTTGAGTATTATTTGGTGGGTGCAATGAGGGGATGTGGGGG
GAAAAAAACTGCTTTACCGCGTAATATAAATATATCAGGAAGTAAACATTCCACCCGAACAAAACATGGTCACTGTGCATACCGAATGAT
AATCACTTGGCTTCATCTACTTCACTCTTTGCCATCGGCAGCACGGAGGGAGCCTAATTCAACTGGAGCTTGTGTTCCCACAACTTTGGA
TGATCCAXTAAGCGGACACATCGGCACCCTTCACCTTCTCTTTCTCAATTTGTTCCTTTATCCAGAAATATGTAATCCTCAACCCATCCT
TCAACTTCATATTAGGAGCCCAGCCAAGCTTTTCCTTGATGAGAGTGTTGTCAAAGTTTCGACCACgCACACCCTCTGGTCCTGGAXATG
TGATGGATCGGAAGGTTCTTGCCATCAAAGCTGAGGACTATCTCTGCCATCTCATTCATGCTTACCATCTCATCACTTCCGATGTTCACA
GGCTCTCTGAAGTcGGATTTTGTTAAXCCTCAGAACACCTTCAACACACTCATCAATGAAGGTGAAAGATCGAGTTTGCTTTCCCGACTT
TCTGACCTGCTCGATAACCTCCGTCTCTCTCTCCGTTCGAAACAAATTTCTAGGGTTTTGGATTGTTGA(3')TTTAAATTTATATTATC
GGAATA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan