ESTScan Details for Unigene SGN-U579475

Score 
171
Direction 
Forward
Predicted Peptide Sequence 
RPGTISSFTLSHTITSRSTTMAATDNVNNNSVSKPSLYLQNMDEVQKVFQRFDTNGDGMISGEELSGVISALGSGTSPEEVSRMMNEIDS
DRDGFISLQEFAEFCKGDINSIGDGGVRELREAFDLYDQDSNGLISAAELHQILTRLGENCSVQDCTKMINSVDSDGDGYVSFEEFKKMM
TTSKRLFQSLFYYPFLAADKGEVHGIIVRPLYXDIVSPLTDDRRRNRKDKL*
Predicted Coding Sequence 
CGGCCGGGGACCATTTCAAGTTTTACTCTTTCTCATACTATTACTTCCAGATCAACGACAATGGCTGCTACCGACAATGTCAACAATAAC
TCCGTTTCCAAGCCTTCTCTTTACCTTCAGAACATGGATGAGGTGCAGAAAGTGTTTCAACGGTTCGACACGAACGGCGACGGCATGATA
TCCGGCGAAGAGCTCTCCGGCGTCATCAGTGCTCTTGGATCTGGTACATCTCCTGAAGAAGTCTCTCGTATGATGAATGAAATTGATTCT
GACAGAGACGGTTTCATTAGCCTTCAGGAATTTGCTGAGTTCTGTAAAGGCGACATTAACAGCATCGGTGACGGTGGCGTTAGGGAGCTT
CGTGAAGCGTTTGATCTGTACGATCAGGACAGTAACGGATTGATCTCCGCCGCTGAGCTTCATCAGATCCTGACTCGTTTAGGCGAAAAC
TGCTCCGTTCAGGACTGTACCAAAATGATCAACTCCGTTGATTCCGACGGCGACGGTTACGTTAGCTTTGAAGAGTTTAAGAAGATGATG
ACTACCAGCAAGAGGCTCTTTCAGTCTTTGTTTTACTATCCCTTTTTAGCGGCTGATAAAGGTGAGGTGCACGGGATTATAGTGCGTCCC
CTTTATAXGGATATAGTTTCTCCTCTAACTGATGATAGACGGAGAAACCGTAAGGATAAACTTTAA
Edits in Original Sequence 
(5')CGGCCGGGGACCATTTCAAGTTTTACTCTTTCTCATACTATTACTTCCAGATCAACGACAATGGCTGCTACCGACAATGTCAACAA
TAACTCCGTTTCCAAGCCTTCTCTTTACCTTCAGAACATGGATGAGGTGCAGAAAGTGTTTCAACGGTTCGACACGAACGGCGACGGCAT
GATATCCGGCGAAGAGCTCTCCGGCGTCATCAGTGCTCTTGGATCTGGTACATCTCCTGAAGAAGTCTCTCGTATGATGAATGAAATTGA
TTCTGACAGAGACGGTTTCATTAGCCTTCAGGAATTTGCTGAGTTCTGTAAAGGCGACATTAACAGCATCGGTGACGGTGGCGTTAGGGA
GCTTCGTGAAGCGTTTGATCTGTACGATCAGGACAGTAACGGATTGATCTCCGCCGCTGAGCTTCATCAGATCCTGACTCGTTTAGGCGA
AAACTGCTCCGTTCAGGACTGTACCAAAATGATCAACTCCGTTGATTCCGACGGCGACGGTTACGTTAGCTTTGAAGAGTTTAAGAAGAT
GATGACTACCAGCAAGtAGGCTCTTTCtAGTCTTTGTTTTACTATCCCTTTTTAGCGGCTGATAAAGGTGAGGTGCACGGGATTATAGTG
CGTCCCCTTTATAXGGATATAGTTTCTaCCTCTAACTGATGATAGACGGAGAAACCGTAAGGATAAACTTTAA(3')GATGAATTTGTTA
GGGTAACGCCGTTAACAGTAAATGTGGATTCTGAATTTAATGTGATATGAAATTTTAGTTTATTTTTCTGCATTGTTCCCACCTTCTCTT
TCTCGGGGGGGGCCCGGGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan