ESTScan Details for Unigene SGN-U579489

Score 
1806
Direction 
Forward
Predicted Peptide Sequence 
MAAESVTRMSSAASSLCNFNGSKRPVPVSNRVTSSRRNRCVKLQSLASASMSEFFGSSRVFSVNGSRSLGLSQKTRKNGFSVIAMAAAEE
EKRTVPLKDYRNIGIMAHIDAGKTTTTERVLYYTGRNYKIGEVHEGTATMDWMEQEQERGITITSAATTTFWNKHRINIIDTPGHVDFTL
EVERALRVLDGAICLFDSVAGVEPQSETVWRQADKYGVPRICFVNKMDRLGANFFRTRDMIVTNLGAKPLVIQIPIGAEDTFKGRKERIG
RLLEMHANSREDVKTALTGDIVALAGLKDTITGETLSDPEKPVVLERMDFPDPVIKVAIEPKTKADIDKMAQGLIKLAQEDPSFHFSRDE
EINQTVIEGMGELHLEIIVDRLKREFKVEANVGAPQVNYRESISRNSEVKYVHKKQSGGSGQFADITVRFEPMEAGGGYEFKSEIKGGAV
PKEYIPGVMKGLEECMSNGVLAGFPVVDVRAVLVDGSYHDVDSSVLAFQLAARGAFREGMRKAGPQLLEPIMKVEVVTPEEHLGDVIGDL
NSRRGQINSFGDKPGGLKVVDSLVPLAEMFNYVSTLRGMTKGRASYVMQLAKFDVVPQHIQNQLAKKEEAAAAXVSHLPDFGSTNLKIGI
FLDEDVKAWTTFFLYVPAWNTDGEXADIXVMRLSFFRRLCMLLSYKLRLRRDGRKKEGNVYTCI*
Predicted Coding Sequence 
ATGGCAGCAGAGTCAGTGACAAGAATGTCATCTGCTGCTTCTTCACTTTGTAACTTTAATGGGTCTAAAAGACCCGTACCCGTTTCTAAC
AGGGTCACTTCTTCTAGGAGGAATCGATGTGTTAAACTACAGTCACTTGCTTCTGCTTCCATGTCTGAATTCTTTGGTAGTTCACGAGTG
TTCTCTGTTAATGGTTCTAGAAGCTTAGGGTTATCTCAGAAAACAAGAAAGAATGGATTTTCTGTTATTGCTATGGCTGCTGCTGAAGAG
GAGAAGAGAACAGTGCCTTTGAAGGACTATCGCAATATAGGAATTATGGCTCATATAGATGCAGGGAAGACAACTACAACGGAAAGGGTC
CTTTACTATACTGGCAGAAACTATAAAATTGGTGAAGTGCATGAGGGAACTGCCACAATGGACTGGATGGAGCAAGAGCAAGAGAGGGGG
ATTACAATTACTTCTGCTGCTACTACCACCTTCTGGAACAAGCATCGCATCAACATTATTGATACTCCTGGTCACGTGGACTTCACTCTT
GAAGTAGAGCGTGCCCTTAGGGTTTTAGATGGTGCTATATGCTTGTTTGACAGTGTTGCTGGTGTGGAACCTCAATCAGAAACTGTTTGG
AGACAAGCTGATAAATACGGAGTCCCTAGGATATGTTTCGTAAATAAGATGGATCGTCTTGGAGCTAATTTCTTCCGAACAAGAGACATG
ATAGTAACAAACTTGGGTGCTAAACCACTTGTAATTCAGATACCAATTGGTGCAGAGGATACATTCAAAGGCAGGAAAGAGAGAATTGGC
AGACTTCTGGAAATGCATGCTAACAGTAGAGAGGATGTAAAGACAGCGTTAACTGGTGATATTGTTGCTCTTGCTGGATTGAAAGATACA
ATTACAGGAGAGACATTGTCTGATCCCGAGAAGCCTGTTGTGCTTGAGCGCATGGATTTCCCAGATCCTGTTATAAAGGTTGCAATTGAA
CCTAAGACCAAGGCAGACATTGATAAGATGGCGCAAGGTTTAATAAAACTGGCACAAGAGGATCCGTCTTTCCATTTTTCACGTGATGAG
GAGATTAACCAGACAGTTATTGAGGGAATGGGAGAATTACATCTTGAGATCATTGTAGATCGACTGAAAAGGGAATTTAAGGTGGAAGCT
AATGTCGGAGCTCCACAAGTCAACTACCGCGAGAGCATTTCCAGGAACTCAGAAGTAAAATACGTGCATAAGAAGCAGTCTGGTGGTTCA
GGACAGTTTGCTGATATCACAGTAAGGTTTGAACCCATGGAAGCAGGTGGTGGATATGAATTCAAGAGTGAAATCAAGGGAGGTGCAGTG
CCAAAAGAATATATCCCTGGTGTTATGAAGGGATTAGAAGAATGCATGAGTAACGGAGTACTGGCAGGCTTTCCAGTTGTTGATGTTCGT
GCTGTGCTAGTAGATGGATCTTACCATGATGTGGATTCAAGTGTTTTGGCATTCCAGCTGGCTGCTCGGGGAGCTTTTAGGGAAGGGATG
AGAAAAGCTGGTCCACAATTGCTAGAACCCATAATGAAGGTTGAAGTAGTTACACCAGAAGAACATCTAGGGGATGTGATTGGTGACCTT
AACTCAAGGAGAGGCCAGATCAACAGCTTTGGAGACAAGCCTGGAGGTCTCAAGGTGGTGGATTCTTTAGTTCCATTAGCAGAGATGTTC
AATTACGTTAGTACCTTGCGAGGAATGACAAAGGGGCGTGCATCGTATGTTATGCAGTTAGCCAAATTTGACGTTGTCCCTCAACACATT
CAAAACCAGCTTGCCAAAAAGGAGGAAGCAGCTGCTGCTXTAGTCAGTCATCTTCCAGATTTTGGATCCACAAACTTGAAAATAGGTATT
TTTCTCGACGAAGATGTTAAGGCTTGGACAACATTCTTTTTGTACGTACCAGCATGGAACACCGATGGAGAAXTAGCTGATATTXTAGTC
ATGCGTCTGAGTTTTTTCAGACGTTTGTGTATGTTGTTGAGTTATAAGCTGAGACTCCGAAGAGACGGAAGAAAGAAAGAAGGAAATGTG
TATACATGCATTTAA
Edits in Original Sequence 
GTAAACAAGTACAAATATAAACACACTATAACCAGAAAAACAGAGGAGGAGAAAAAGAA(5')ATGGCAGCAGAGTCAGTGACAAGAATG
TCATCTGCTGCTTCTTCACTTTGTAACTTTAATGGGTCTAAAAGACCCGTACCCGTTTCTAACAGGGTCACTTCTTCTAGGAGGAATCGA
TGTGTTAAACTACAGTCACTTGCTTCTGCTTCCATGTCTGAATTCTTTGGTAGTTCACGAGTGTTCTCTGTTAATGGTTCTAGAAGCTTA
GGGTTATCTCAGAAAACAAGAAAGAATGGATTTTCTGTTATTGCTATGGCTGCTGCTGAAGAGGAGAAGAGAACAGTGCCTTTGAAGGAC
TATCGCAATATAGGAATTATGGCTCATATAGATGCAGGGAAGACAACTACAACGGAAAGGGTCCTTTACTATACTGGCAGAAACTATAAA
ATTGGTGAAGTGCATGAGGGAACTGCCACAATGGACTGGATGGAGCAAGAGCAAGAGAGGGGGATTACAATTACTTCTGCTGCTACTACC
ACCTTCTGGAACAAGCATCGCATCAACATTATTGATACTCCTGGTCACGTGGACTTCACTCTTGAAGTAGAGCGTGCCCTTAGGGTTTTA
GATGGTGCTATATGCTTGTTTGACAGTGTTGCTGGTGTGGAACCTCAATCAGAAACTGTTTGGAGACAAGCTGATAAATACGGAGTCCCT
AGGATATGTTTCGTAAATAAGATGGATCGTCTTGGAGCTAATTTCTTCCGAACAAGAGACATGATAGTAACAAACTTGGGTGCTAAACCA
CTTGTAATTCAGATACCAATTGGTGCAGAGGATACATTCAAAGGCAGGAAAGAGAGAATTGGCAGACTTCTGGAAATGCATGCTAACAGT
AGAGAGGATGTAAAGACAGCGTTAACTGGTGATATTGTTGCTCTTGCTGGATTGAAAGATACAATTACAGGAGAGACATTGTCTGATCCC
GAGAAGCCTGTTGTGCTTGAGCGCATGGATTTCCCAGATCCTGTTATAAAGGTTGCAATTGAACCTAAGACCAAGGCAGACATTGATAAG
ATGGCGCAAGGTTTAATAAAACTGGCACAAGAGGATCCGTCTTTCCATTTTTCACGTGATGAGGAGATTAACCAGACAGTTATTGAGGGA
ATGGGAGAATTACATCTTGAGATCATTGTAGATCGACTGAAAAGGGAATTTAAGGTGGAAGCTAATGTCGGAGCTCCACAAGTCAACTAC
CGCGAGAGCATTTCCAGGAACTCAGAAGTAAAATACGTGCATAAGAAGCAGTCTGGTGGTTCAGGACAGTTTGCTGATATCACAGTAAGG
TTTGAACCCATGGAAGCAGGTGGTGGATATGAATTCAAGAGTGAAATCAAGGGAGGTGCAGTGCCAAAAGAATATATCCCTGGTGTTATG
AAGGGATTAGAAGAATGCATGAGTAACGGAGTACTGGCAGGCTTTCCAGTTGTTGATGTTCGTGCTGTGCTAGTAGATGGATCTTACCAT
GATGTGGATTCAAGTGTTTTGGCATTCCAGCTGGCTGCTCGGGGAGCTTTTAGGGAAGGGATGAGAAAAGCTGGTCCACAATTGCTAGAA
CCCATAATGAAGGTTGAAGTAGTTACACCAGAAGAACATCTAGGGGATGTGATTGGTGACCTTAACTCAAGGAGAGGCCAGATCAACAGC
TTTGGAGACAAGCCTGGAGGTCTCAAGGTGGTGGATTCTTTAGTTCCATTAGCAGAGATGTTCAATTACGTTAGTACCTTGCGAGGAATG
ACAAAGGGGCGTGCATCGTATGTTATGCAGTTAGCCAAATTTGACGTTGTCCCTCAACACATTCAAAACCAGCTTGCCAAAAAGGAGGAA
GCAGCTGCTGCTXTAGTCAGTCATCTTCCAGATTTTGGATCCACAAACTTGAAAATAGGTATTTTTaCTCGACGAAGATGTTAAGGCTTG
GACAACATTCTTTTTGTACGTACCAGCATGGAACACCGATGGAGAAXTAGCTGATATTXTAGTCATGCGTCTGAGTTTTTTCAGACGTTT
GTGTATGTTGTTGAGTTATAAGCTGAGACTCCGAAGAGACGGAAGAAAGAAAGAAGGAAATGTGTATACATGCATTTAA(3')GATGTCT
CTACATCCAAAAGAAGCATCAATATTTTAGGGCAAGATTGAGTGTGTCTCCGATTGTGGGATTATTTTTCTTACTATAGAAATAAATATA
TGCTTTGTAACAATCTGATGCTCTTTATTGAGATCTTAGGTGTAACATCTGACGATTTTGAGTTGCTTATTTCACGTTTGTTTTTACTTT
GCACTTCTGTTATAATATTACGTACCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan