ESTScan Details for Unigene SGN-U579638

Score 
660
Direction 
Forward
Predicted Peptide Sequence 
AVAAMEVEAAAAAAIWPXLLESWTEFAAMASSVMSSAAVATRGNGAQASMVAPFTGLKSTASFPVSRKQNLDITSIASNGGRVSCMQVWP
PINMKKYETLSYLPDLSDEQLLSEIEYLLKNGWVPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYP
QAWVRIIGFDNVRQVQCISFIAYKPEGY*
Predicted Coding Sequence 
GCAGTAGCCGCCATGGAAGTAGAAGCTGCTGCTGCTGCTGCCATTTGGCCAAXTCTTTTAGAATCTTGGACTGAGTTTGCAGCAATGGCT
TCTTCAGTAATGTCCTCAGCAGCTGTTGCCACCCGCGGCAATGGTGCACAAGCTAGCATGGTTGCACCCTTCACTGGACTCAAGTCCACC
GCTTCTTTCCCTGTTTCAAGGAAGCAAAACCTTGACATTACCTCCATTGCTAGCAACGGTGGAAGAGTCAGTTGCATGCAGGTGTGGCCA
CCAATTAACATGAAGAAGTACGAGACTCTGTCGTACCTTCCTGATTTGTCCGACGAGCAATTGCTCAGCGAAATTGAGTACCTATTGAAA
AATGGATGGGTTCCTTGCTTGGAATTCGAGACTGAGCACGGATTTGTGTACCGTGAGAACCATAAGTCACCAGGATACTACGATGGCAGA
TACTGGACCATGTGGAAGTTGCCCATGTTCGGGTGCACTGATGCAACCCAGGTCTTGGCTGAGGTGCAGGAGGCAAAGAAGGCTTACCCA
CAGGCATGGGTCCGTATCATCGGATTCGACAATGTTCGTCAAGTGCAGTGCATCAGTTTCATCGCTTACAAGCCCGAAGGATACTAA
Edits in Original Sequence 
(5')GCAGTAGCCGCCATGGAAGTAGAAGCTGCTGCTGCTGCTGCCATTTGGCCAAXTCTTTTAGAATCTTGGACTGAGTTTGCAGCAAT
GGCTTCTTCAGTAATGTCCTCAGCAGCTGTTGCCACCCGCGGCAATGGTGCACAAGCTAGCATGGTTGCACCCTTCACTGGACTCAAGTC
CACCGCTTCTTTCCCTGTTTCAAGGAAGCAAAACCTTGACATTACCTCCATTGCTAGCAACGGTGGAAGAGTCAGTTGCATGCAGGTGTG
GCCACCAATTAACATGAAGAAGTACGAGACTCTGTCGTACCTTCCTGATTTGTCCGACGAGCAATTGCTCAGCGAAATTGAGTACCTATT
GAAAAATGGATGGGTTCCTTGCTTGGAATTCGAGACTGAGCACGGATTTGTGTACCGTGAGAACCATAAGTCACCAGGATACTACGATGG
CAGATACTGGACCATGTGGAAGTTGCCCATGTTCGGGTGCACTGATGCAACCCAGGTCTTGGCTGAGGTGCAGGAGGCAAAGAAGGCTTA
CCCACAGGCATGGGTCCGTATCATCGGATTCGACAATGTTCGTCAAGTGCAGTGCATCAGTTTCATCGCTTACAAGCCCGAAGGATACTA
A(3')ATGTGTATATGTCAACAGTGAGAAACTGTTCGCATTTTCCGTTTTGCTTCTTTCTTTCTATTCAATGTATGTTGTTGGATTCCAG
TTGAATTTATTATGAGAACTAATAATAATAGTAATAATCATTTGTTTCTTTACTAATTTGCATTTTCACATGTGAAAAAAAAAAAAAAAA
TGAAAAAAAAAAAACCTGGAGACTAGTTCTCTCTCCAACAACCCCCAAAATTATTAATTTTTTTTTTAAAAAAAAATGTATTTTCAAGCC
TTGATCCTCTTCTCTCTTGGCATCATCTCCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan