ESTScan Details for Unigene SGN-U579736

Score 
744
Direction 
Reverse
Predicted Peptide Sequence 
MMNAAEPHFSHHTAAVGVFITEEGAELSLGGGGWPSNTGCMVLEVACXLTAGGGRAYIIGXKPFVPIGTAAVVAASSXAAIVAAGSXGLP
AMTSGPALGSRAAKAVKSGSTFKKKSQKIRTKVTFHRPRTLKKDRSPKYPRVSAPGRNKLDQYAILKYPLTTESAMKKIEDNNTLVFIVD
IKADKKKIKAAVKKMYDIQTKKINTLIRPDGTKKAYVRLTPDYDALDVANKIGII*
Predicted Coding Sequence 
ATGATGAATGCAGCAGAGCCACACTTCTCACATCACACTGCAGCTGTTGGTGTTTTCATCACTGAAGAAGGTGCTGAGTTATCACTTGGA
GGTGGTGGATGGCCTAGTAATACGGGTTGTATGGTGCTGGAGGTGGCATGTAXATTGACAGCAGGTGGTGGTCGAGCGTACATCATTGGT
XTGAAACCTTTCGTTCCCATTGGCACXGCTGCTGTTGTTGCTGCATCATCAXTAGCTGCCATTGTTGCTGCTGGTAGTAAXGGATTGCCA
GCCATGACTTCAGGACCAGCACTTGGAAGTAGGGCTGCCAAGGCTGTCAAGTCAGGATCAACCTTCAAGAAGAAGTCACAGAAGATCAGG
ACAAAGGTTACATTCCACCGTCCTAGGACTTTGAAGAAGGATAGAAGCCCCAAGTATCCTCGTGTTAGTGCACCTGGAAGGAACAAACTT
GATCAATATGCTATTCTAAAGTATCCTCTCACCACCGAGTCTGCAATGAAGAAGATTGAAGACAATAACACCCTTGTTTTCATTGTTGAC
ATCAAAGCTGATAAGAAGAAGATCAAGGCTGCTGTGAAGAAGATGTATGACATTCAGACTAAGAAAATCAATACCTTGATCAGGCCTGAT
GGAACTAAGAAGGCATATGTGAGGTTGACTCCAGACTATGACGCTTTGGATGTGGCCAACAAAATCGGGATCATCTAA
Edits in Original Sequence 
CCAATTTTATTTGTTTTGCTCTCTTCTTGATCAAAGATATATAAAACATATACAAACATCTTCTTCCAACTTACAACATTCCATGTCCCT
CCTCTCTCTCTACTAAAGACTTCATATACCATTAAACTCTATCATGAAATTAAACCCCTAATCTAATCTTAGGATTAAAAAAGGTAAATA
AGTAAAACAAAGCTAAGGTAAGGATCAAAGGGAAAATTAATCTCCTTTGTATATTATGGCATTAATTAAAAGACTAAGGAAGTCACTTAG
ACT
(5')ATGATGAATGCAGCAGAGCCACACTTCTCACATCACACTGCAGCTGTTGGTGTTTTCATCACTGAAGAAGGTGCTGtAGTTAT
CACTTGGAGGTGGTGGATGGCCgTAGTAATACGGGTTGTATGGTGCTGGAGGTGGCATGTAXATTGACAGCAGGTGGTGGTCGAGCGTAC
ATCATTGGTXTGAAACCTTTCGTTCCCATTGGCACXGCTGCTGTTGTTGCTGCATCATCAXTAGCTGCCAtTTGTTGCTGCTGGTAGTAA
XGGATTGCCAGCCATGACTTCAGGACCAGCAcCTTGGAAGTAGGGCTGCCAAGGCTGTCAAGTCAGGATCAACCTTCAAGAAGAAGTCAC
AGAAGATCAGGACAAAGGTTACATTCCACCGTCCTAGGACTTTGAAGAAGGATAGAAGCCCCAAGTATCCTCGTGTTAGTGCACCTGGAA
GGAACAAACTTGATCAATATGCTATTCTAAAGTATCCTCTCACCACCGAGTCTGCAATGAAGAAGATTGAAGACAATAACACCCTTGTTT
TCATTGTTGACATCAAAGCTGATAAGAAGAAGATCAAGGCTGCTGTGAAGAAGATGTATGACATTCAGACTAAGAAAATCAATACCTTGA
TCAGGCCTGATGGAACTAAGAAGGCATATGTGAGGTTGACTCCAGACTATGACGCTTTGGATGTGGCCAACAAAATCGGGATCATCTAA
(3')ATTAGTTTTCCTGTTTAGAATTTTGAGGAGAATTTAGAATTTCATGAAACACTTTAATGGAAGTGCCTTGTGTTTTGAATTTTGAAT
TTTGCTTTCCTGTTTTATTCCATATTTTTGTTATAATAGAATTCAACCTTGTGCTCCTAGTGAGTACTTGACAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan