ESTScan Details for Unigene SGN-U579768

Score 
792
Direction 
Reverse
Predicted Peptide Sequence 
MSLMLKQQLLPATVSLGDESFMASSVDFPSTAFHASHFALSLMLNMPGRLXVDIANGGLLVKSVKNKLVLIGGTLRQCLAFSACASNSSF
KAMIDLVSLKKREKTGDVIVIGTRLLLRWLTDTQRERKNSVFFRAANDSSAVFSGKKKDGSLRGTEKLKKHYIVTVFVCFIDQVFSRRSD
KKWVIVDFXNPNKKSYDASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGATVNLGLWDTAGQEDYNRLRPLSY
RGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFVDHPGAVPITTAQGEELRKTIGAPSYVECSSKTQQN
VKGVFDAAIKVVLQPPKTKKKKGKSQKALLDIVINYRSTDMAHHSSRCNIPLISLCLGGSRRFSSLLFGTTND
Predicted Coding Sequence 
ATGAGCCTTATGCTGAAGCAGCAGCTTCTTCCAGCAACTGTTTCACTTGGTGATGAGTCGTTCATGGCTTCATCGGTGGATTTTCCTTCA
ACAGCCTTCCATGCATCCCACTTTGCTCTGTCTCTCATGTTGAACATGCCAGGACGGCTTGXTGTTGACATCGCCAACGGTGGCTTGCTT
GTAAAGTCCGTAAAGAATAAGCTTGTTCTCATTGGTGGTACTCTCAGGCAATGTCTTGCTTTCTCAGCATGTGCTTCAAATTCCTCCTTC
AAAGCCATGATTGATCTGGTTAGCTTGAAAAAACGCGAGAAAACTGGAGATGTGATTGTGATCGGCACGAGGCTTCTTCTTCGTTGGTTG
ACAGACACACAGAGAGAGAGAAAAAACAGTGTTTTTTTCAGGGCAGCGAACGATTCAAGCGCAGTATTTTCCGGCAAGAAAAAAGATGGG
TCATTGAGAGGGACTGAAAAATTGAAGAAGCATTACATTGTTACXGTTTTTGTTTGTTTTATTGATCAGGTCTTCTCAAGAAGATCTGAT
AAGAAGTGGGTCATCGTTGATTTTXTAAACCCAAACAAGAAAAGTTATGATGCTTCCAGGTTTATCAAGTGTGTTACAGTGGGTGATGGT
GCTGTTGGAAAGACTTGTCTTTTGATTTCTTACACCAGCAATACTTTCCCTACGGATTATGTGCCCACTGTGTTCGACAATTTCAGTGCA
AATGTGGTTGTCAATGGAGCCACTGTCAATCTAGGGTTGTGGGATACTGCTGGACAGGAGGACTACAACAGATTAAGACCTCTGAGTTAC
CGTGGGGCCGATGTTTTCATTTTGGCATTCTCTCTCATTAGTAAAGCCAGCTATGAGAATGTCTCCAAGAAGTGGATTCCTGAGTTGAAG
CACTATGCTCCTGGTGTCCCGATAGTACTTGTTGGAACAAAACTTGATCTTCGGGATGATAAACAATTTTTCGTGGATCATCCTGGTGCT
GTGCCGATTACTACTGCTCAGGGTGAGGAGCTAAGGAAAACAATTGGTGCACCATCTTACGTTGAATGTAGTTCAAAAACACAACAGAAT
GTGAAAGGAGTCTTTGATGCTGCCATTAAGGTCGTCCTCCAGCCTCCCAAGACAAAGAAAAAGAAGGGTAAATCTCAAAAGGCXCTGCTC
GATATTGTGATCAACTATAGGTCCACCGATATGGCTCATCACAGTTCTCGTTGTAACATCCCCCTTATATCCCTTTGTCTCGGAGGAAGT
AGAAGGTTCTCATCTCTCTTATTCGGAACTACTAACGAT
Edits in Original Sequence 
TGGAGATGGTAATCCATTCCCATTTGTTCCATAACAAACTCCTGTTTGTGCTCCTGTGAAATCTCAGGTAGCCAATATAAGTATCACCAG
CAGAGTCGTCGCGGTAATTGGCAAACGTAGTTTGGTAGCAAGCCTCGTGCCGAATTCGGCTAGAGGCCTCGGAACCAAGTAGCTTTTTTT
TTTTTTTAAAGAAACCAAATTCAAACTTTTTTAGGGGTTTATTATAGAAGGTTCAGACATACTTATAGCAGTAATTTTTTTTCCTAGCCA
GGAAAAGGCATACACCTGCTGTTGCACTAAAATCAAACAAGCCACATAATCCAGTTCCAATAACAATTTAACAACATAGATAG
(5')ATG
AGCCTTATGCTGAAGCAGCAGCTTCTTCCAGCAACTGTTTCAcCTTGGTGATGtAGTCGTTCATGGCTTCATCGGTGGATTTTCCTTCAA
CAGCCTTCCATGCATCCCACTTTGCTCTGTCTCTCATGTTGAACATGCCAGGACGGCTTGXTGTTGACATCGCCAACGGTGGCTTGCTTG
TAAAGTCCGTAAAGAATAAGCTTGTTCTCATTGGTGGTACTCTCAGGCAATGTCTTaGCTTTCTCAGCATGTGCTTCAAATTCCTCCTTC
AAAGCCATGATcTGATCTGGTTAGCTTGAtAAAAACGCGAGAAAACTGGAGATGTGATTGTGATCGGCACGAGGCTTCTTCTTCGTTGGT
TGACAGACACACAGAGAGAGAGAAAAAACAGTGTTTTTTTCAGGGCAGCGAACGATTCAAGCGCAGTATTTTCCGGCAAGAAAAAAGATG
GGTCATTGAGAGGGACTGAAAAATTGAAGAAGCATTACATTGTTACXGTTTTTGTTTGTTTTATTGATCAGGTCTTCTCAAGAAGATCTG
ATAAGAAGTGGGTCATCGTTGATTTTXTAAACCCAAACAAGAAAAGTTATGAgTGCTTCCAGGTTTATCAAGTGTGTTACAGTGGGTGAT
GGTGCTGTTGGAAAGACTTGTCTTTTGATTTCTTACACCAGCAATACTTTCCCTACGGATTATGTGCCCACTGTGTTCGACAATTTCAGT
GCAAATGTGGTTGTCAATGGAGCCACTGTCAATCTAGGGTTGTGGGATACTGCTGGACAGGAGGACTACAACAGATTAAGACCTCTGAGT
TACCGTGGGGCCGATGTTTTCATTTTGGCATTCTCTCTCATTAGTAAAGCCAGCTATGAGAATGTCTCCAAGAAGTGGATTCCTGAGTTG
AAGCACTATGCTCCTGGTGTCCCGATAGTACTTGTTGGAACAAAACTTGATCTTCGGGATGATAAACAATTTTTCGTGGATCATCCTGGT
GCTGTGCCGATTACTACTGCTCAGGGTGAGGAGCTAAGGAAAACAATTGGTGCACCATCTTACGTTGAATGTAGTTCAAAAACACAACAG
AATGTGAAAGGAGTCTTTGATGCTGCCATTAAGGTCGTCCTCCAGCCTCCCAAGACAAAGAAAAAGAAGGGTAAATCTCAAAAGGCXCTG
CTCGATATTGTGATCAACTATAGGTCCACCGATATGGCTCATCACAGTTCTCGTTGTAACATCCCCCTTATATCCCTTTGTCTCGGAGGA
AGTAGAAGGTTCTCATCTCTCTTATTCGGAACTACTAACGAT(3')CCCTCAAAAAGTGTTTCAGGTGGCTTGGTTTTTCTGTATAATTG
TTGTTCACCATGTAGGCCACTCTAGTGTTTCCTTTCTTTTGATTCGATTTAGTGTATTCACAATTGAATGATCCTCAGTTAGGAAAACAA
AAAAGTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan