Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U579793

Score 
288
Direction 
Forward
Predicted Peptide Sequence 
MGEKGLQTPARKVYLWVRKQSKKVKTVLGVVTCLTLLITLRLLIHDHNHFFVLAEFVHFIGXLMFDLQVVYSQNLLRLVIEESSAYGDLS
GCKSILSFIMEGDIHTILDFVTLAATLWVIYMMKFKLKSSFMTDLDNMHYLYLIVPCVVAAFLIHPATAHNFFFRILWAFCVYMESISVL
PQLRLMQNVQIIEPFTAHYVFALGVARFLGCAHWINQVYDTSGAYLYLAGRGYFWIPMVFLAEIVQTFILADFCYYYIKSVMSGQLLVRL
PQPV*
Predicted Coding Sequence 
ATGGGTGAAAAGGGTTTACAAACGCCGGCGAGGAAAGTGTATTTGTGGGTTCGAAAGCAATCGAAGAAGGTGAAGACTGTTTTAGGTGTT
GTTACATGTCTCACCTTACTCATTACTCTCAGATTACTCATCCATGACCACAATCACTTCTTTGTTTTAGCTGAGTTTGTTCATTTCATC
GGTXATCTTATGTTTGATTTACAAGTTGTCTACTCTCAAAACTTGCTCAGGCTTGTCATTGAAGAGTCAAGTGCTTACGGCGATCTTTCT
GGCTGTAAGAGTATTTTGAGTTTCATCATGGAAGGAGATATACACACCATTCTAGATTTTGTTACACTTGCGGCAACATTGTGGGTAATA
TATATGATGAAGTTCAAGTTGAAGTCGTCCTTCATGACAGATCTGGATAATATGCACTATTTGTATTTGATTGTGCCTTGTGTGGTTGCA
GCCTTCTTAATCCATCCTGCTACGGCTCATAATTTCTTCTTCCGGATTCTTTGGGCTTTTTGTGTATACATGGAGTCTATCTCAGTGCTG
CCTCAGCTTCGCTTGATGCAGAATGTCCAGATAATTGAGCCGTTCACAGCTCATTATGTGTTTGCATTGGGTGTTGCAAGATTCTTGGGC
TGTGCTCATTGGATTAATCAGGTCTATGACACTAGCGGAGCATATCTATATTTGGCTGGACGGGGTTACTTTTGGATACCGATGGTCTTT
TTGGCGGAAATTGTTCAAACGTTTATTTTGGCAGATTTCTGCTACTATTACATAAAGAGTGTCATGAGCGGTCAACTTTTGGTCCGTCTG
CCGCAGCCTGTATAG
Edits in Original Sequence 
CATTAATTAGTTGTGTATAGTTTATAGTGCATAACAGTAATCAAATCAAAAGGAAGAAGAA(5')ATGGGTGAAAAGGGTTTACAAACGC
CGGCGAGGAAAGTGTATTTGTGGGTTCGAAAGCAATCGAAGAAGGTGAAGACTGTTTTAGGTGTTGTTACATGTCTCACCTTACTCATTA
CTCTCAGATTACTCATCCATGACCACAATCACTTCTTTGTTTTAGCTGAGTTTGTTCATTTCATCGGTXATCTTATGTTTGATTTACAAG
TTGTCTACTCTCAAAACTTGCTCAGGCTTGTCATTGAAGAGTCAAGTGCTTACGGCGATCTTTCTGGCTGTAAGAGTATTTTGtAGTTTC
ATCATGGAAGGAGATATACACACCATTCTAGATTTTGTTACACTTGCGGCAACATTGTGGGTAATATATATGATGAAGTTCAAGTTGAAG
TCGTCCTTCATGACAGATCTGGATAATATGCACTATTTGTATTTGATTGTGCCTTGTGTGGTTGCAGCCTTCTTAATCCATCCTGCTACG
GCTCATAATTTCTTCTTCCGGATTCTTTGGGCTTTTTGTGTATACATGGAGTCTATCTCAGTGCTGCCTCAGCTTCGCTTGATGCAGAAT
GTCCAGATAATTGAGCCGTTCACAGCTCATTATGTGTTTGCATTGGGTGTTGCAAGATTCTTGGGCTGTGCTCATTGGATTAATCAGGTC
TATGACACTAGCGGAGCATATCTATATTTGGCTGGACGGGGTTACTTTTGGATACCGATGGTCTTTTTGGCGGAAATTGTTCAAACGTTT
ATTTTGGCAGATTTCTGCTACTATTACATAAAGAGTGTCATGAGCGGTCAACTTTTGGTCCGTCTGCCGCAGCCTGTATAG(3')AAGTT
CAAATTACTATATCCTACAAAATGTAACATATGTTGTATTTCTTGTGTTATGGTGTGGATATAGAGCTTCTTCTACCTCGTATTTTCTGT
TTTTCATCTTCTCCTCTGTTCTCTAGTTCCTCTCTTGCCAATGCAACTGAACATATAAATAAATAAATAAATTTGCTAGATGCATTGCCA
CGACTGATCTTGCTTCTTGATCTTGCTTCTTGAAGTCTTGAGCACCTAATTTTCTGGAGATTGTTTCTGTACTAGGCTGAATTTTGGATT
GATCTTTCACTTGACATCCAAGTTGATACAGCGTTTAGAACGATACACTCAATGTCAACAGCATAGCTTTTTCCTTATACAGGTATCTTT
TGCGTGGATGGGGTACTCTTTTGAACAAAGAAGAGCTTGGACGACAGCATAGCTTTTTCTTTCTCCGGACTCTTCCCAGAGAAGAGGATC
TTTAATTTTTCTTTCTCCGGACTCTTCCCAGAGAAGAGGATCTTTACATTCCTAGTACGGTAGAGTGAGGATTGCTTGATAACTCCTTGA
TTAAGCTCATTTCTTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan