ESTScan Details for Unigene SGN-U579869

Score 
1156
Direction 
Forward
Predicted Peptide Sequence 
XKQDAALG*FYKFYNIYLYKLSTSFQAFSSIMEATAPLVVKPSNVKELAESPDLRCIPYNYVYDSSNSSATNDIDDSDSIPIVDFSLLTS
HDSHQRSTAIHHLTKACQGWGFFMVVNHGIPENLMKSVIDCTHEFFNLPEEEKHKFTGKHVLDPIRYGTSFNTSTENVFFWRDFLKVFVH
PHFHSPTKPQTYRGIMSEYSXETPGSDKKVTGGISESLGLEESYLEKDLELESGLQIFVGNYYPPCPQPELAMGMPPHSDQGLLTLLIHN
QVGGLQVQHQGKWINVKALPNYSLLVNTGDHLEIFSNGKYKSNMHRAVVNNKVTRISVVVAHGPSLDTIVKPASPLMEKENSPSANYIPM
KYKDYLEMQQSSRIYGKSCLEKVKIQRS*
Predicted Coding Sequence 
XGTAAACAGGATGCTGCACTTGGGTAATTTTACAAATTCTACAACATTTATCTCTATAAATTATCAACCTCTTTCCAAGCATTTTCATCA
ATTATGGAAGCTACAGCTCCACTTGTGGTTAAACCATCCAATGTCAAAGAGCTTGCTGAATCTCCTGATTTGCGTTGCATACCTTACAAT
TATGTTTATGACTCTTCCAATTCCTCTGCTACAAATGATATTGATGATTCAGATTCAATCCCCATTGTTGATTTTTCTCTACTCACCTCT
CATGATTCTCATCAACGTTCTACAGCCATCCACCACCTCACCAAAGCTTGTCAAGGTTGGGGCTTCTTCATGGTAGTGAACCACGGCATA
CCAGAAAATCTGATGAAGTCAGTGATTGATTGCACTCATGAATTTTTCAATTTACCAGAGGAAGAAAAACACAAGTTTACTGGGAAGCAT
GTGTTGGATCCTATAAGATATGGGACAAGTTTCAATACTAGTACAGAAAATGTCTTCTTTTGGAGAGATTTTCTCAAGGTCTTTGTCCAT
CCTCATTTTCACTCTCCCACCAAACCACAAACCTACAGGGGTATTATGTCGGAGTATAGTGAXGAAACTCCGGGAAGTGACAAGAAAGTT
ACTGGAGGCATATCTGAAAGTTTAGGGCTTGAAGAAAGTTACTTGGAGAAAGATTTAGAGTTGGAATCAGGGCTTCAAATCTTCGTTGGA
AATTACTATCCACCTTGTCCTCAACCTGAACTAGCAATGGGTATGCCACCTCATTCAGATCAAGGCCTTTTAACACTTCTCATTCATAAC
CAAGTTGGAGGTCTCCAGGTTCAACATCAAGGCAAATGGATTAACGTCAAGGCCCTTCCTAACTACTCTCTCTTGGTTAATACCGGCGAT
CATCTCGAGATATTTAGTAATGGGAAGTACAAGAGCAACATGCATAGAGCAGTGGTGAACAACAAAGTAACAAGGATATCAGTAGTGGTA
GCTCATGGTCCATCATTAGACACAATTGTAAAGCCAGCTTCTCCATTGATGGAAAAAGAGAACAGCCCATCAGCTAATTATATTCCAATG
AAGTACAAGGATTACTTGGAGATGCAACAAAGCAGCCGAATTTATGGAAAGTCCTGCTTGGAAAAAGTTAAAATCCAAAGGAGCTGA
Edits in Original Sequence 
(5')XGTAAACAGGATGCTGaCACTTGGGTAATTTTACAAATTCTACAACATTTATCTCTATAAATTATCAACCTCTTTCCAAGCATTTT
CATCAATTATGGAAGCTACAGCTCCACTTGTGGTTAAACCATCCAATGTCAAAGAGCTTGCTGAATCTCCTGATTTGCGTTGCATACCTT
ACAATTATGTTTATGACTCTTCCAATTCCTCTGCTACAAATGATATTGATGATTCAGATTCAATCCCCATTGTTGATTTTTCTCTACTCA
CCTCTCATGATTCTCATCAACGTTCTACAGCCATCCACCACCTCACCAAAGCTTGTCAAGGTTGGGGCTTCTTCATGGTAGTGAACCACG
GCATACCAGAAAATCTGATGAAGTCAGTGATTGATTGCACTCATGAATTTTTCAATTTACCAGAGGAAGAAAAACACAAGTTTACTGGGA
AGCATGTGTTGGATCCTATAAGATATGGGACAAGTTTCAATACTAGTACAGAAAATGTCTTCTTTTGGAGAGATTTTCTCAAGGTCTTTG
TCCATCCTCATTTTCACTCTCCCACCAAACCACAAACCTACAGGGGTATTATGTCGGAGTATAGTGAXGAAACTCCGGGAAGTGACAAGA
AAGTTACTaGGAGGCATATCTGAAAGTTTAGGGCTTGAAGAAAGTTACTTGGAGAAAGATTTAGAGTTGGAATCAGGGCTTCAAATCTTC
GTTGGAAATTACTATCCACCTTGTCCTCAACCTGAACTAGCAATGGGTATGCCACCTCATTCAGATCAAGGCCTTTTAACACTTCTCATT
CATAACCAAGTTGGAGGTCTCCAGGTTCAACATCAAGGCAAATGGATTAACGTCAAGGCCCTTCCTAACTACTCTCTCTTGGTTAATACC
GGCGATCATCTCGAGATATTTAGTAATGGGAAGTACAAGAGCAACATGCATAGAGCAGTGGTGAACAACAAAGTAACAAGGATATCAGTA
GTGGTAGCTCATGGTCCATCATTAGACACAATTGTAAAGCCAGCTTCTCCATTGATGGAAAAAGAGAACAGCCCATCAGCTAATTATATT
CCAATGAAGTACAAGGATTACTTGGAGATGCAACAAAGCAGCCGAATTTATGGAAAGTCCTGCTTGGAAAAAGTTAAAATCCAAAGGAGC
TGA(3')GTGTTTCTATGTATATTTTCCTCTTGTTTCCAAGTGTTTGATGATATAAAAGTATTATGGAACTTCAATAATATTTATGAATA
CTATAGTTGTACGTGTAATCTTTTAATTAGTGAACGTTTTAGCCGTGTCTGTTTATATGTATATCTTCAAATTAAATGTCATTTTCGGAT
AAGAGGGTGATGCTAGTGAAGTAGGGTCATTCCATATATATGTCCAATTGATGACTCTTCCTACTCAAATTGAAGATTCAATTGCTTCTC
C

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan