ESTScan Details for Unigene SGN-U579878

Score 
2720
Direction 
Forward
Predicted Peptide Sequence 
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVAMNPINTVFDAKRLIGRRFSDASVQSDI
KLWPFKVTPGPGDKPMIVVNYKGEEKQFSAEEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP
TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKHKKDITGNPRALRRLR
TACERAKRTLSSTAQTTIEIDSLYEGVDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYE
GERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAERYKAEDEEHKK
KVEAKNALENYAYNMRNTIKDDKISSKLSADDKKKIEDAIDQAISWLDSNQLAEADEFEDKMKELESLCNPIIAKMYQGAGGEAGAPMDD
DDAPPAGSTGAGPKIEEVD*
Predicted Coding Sequence 
ATGGCCGGGAAAGGTGAAGGTCCGGCGATCGGTATAGATCTAGGAACTACTTACTCTTGCGTTGGAGTTTGGCAGCATGATCGTGTTGAG
ATTATTGCTAATGACCAAGGGAACAGGACGACTCCTTCTTACGTTGGTTTTACTGATTCTGAGCGTCTCATTGGCGATGCTGCTAAGAAT
CAAGTCGCCATGAATCCTATTAACACCGTGTTTGATGCCAAGCGTCTTATTGGAAGGAGGTTCAGTGATGCCTCTGTACAGAGTGACATC
AAACTGTGGCCTTTTAAGGTTACTCCTGGACCTGGTGACAAGCCAATGATTGTTGTTAACTACAAGGGAGAAGAGAAACAGTTTTCTGCT
GAAGAAATCTCTTCCATGGTTCTTATTAAGATGAAGGAAATTGCCGAGGCCTTCCTTGGGTCAACAGTGAAGAATGCTGTGGTTACTGTG
CCTGCATACTTCAATGACTCGCAACGTCAGGCTACTAAGGATGCTGGTGTCATATCTGGCTTGAATGTCATGCGTATTATTAATGAGCCC
ACAGCAGCTGCCATTGCCTATGGTCTTGACAAAAAGGCCACTAGTGTTGGTGAGAAGAATGTTCTTATCTTTGATCTCGGTGGTGGTACC
TTTGATGTGTCCCTCCTCACTATTGAAGAGGGTATCTTTGAGGTGAAAGCCACAGCAGGAGACACTCACCTTGGTGGTGAAGATTTTGAT
AACAGAATGGTGAACCACTTTGTCCAGGAATTTAAAAGAAAGCACAAGAAGGATATCACCGGTAACCCTAGGGCCCTTAGAAGATTGAGG
ACAGCTTGTGAAAGAGCAAAAAGAACTCTTTCCTCCACTGCCCAGACAACAATCGAAATTGATTCCCTATATGAGGGAGTTGACTTCTAT
TCAACCATTACTCGTGCCAGATTTGAGGAGTTAAACATGGATCTTTTCAGGAAGTGTATGGAGCCTGTAGAGAAGTGTTTGAGGGATGCC
AAGATGGACAAGAGCTCTGTACACGATGTTGTTCTTGTTGGTGGTTCCACCAGAATTCCCAAGGTACAACAGCTGTTGCAAGACTTCTTT
AATGGAAAGGAGCTTTGCAAGAGTATCAACCCAGATGAGGCTGTTGCCTATGGTGCTGCTGTTCAAGCTGCTATTCTCAGTGGAGAGGGT
AATGAGAAGGTACAAGACTTGTTGCTTTTGGATGTCACCCCTCTATCTCTTGGATTGGAAACTGCTGGAGGAGTCATGACTGTCTTGATT
CCAAGGAATACCACCATTCCTACCAAGAAAGAGCAGGTGTTCTCTACCTATTCTGACAACCAGCCTGGAGTGTTGATTCAGGTTTACGAG
GGTGAGAGAGCAAGGACCAGAGACAACAACTTGTTGGGTAAATTTGAGCTCTCTGGTATTCCTCCTGCTCCTAGGGGTGTGCCTCAGATC
ACGGTCTGCTTTGACATTGATGCCAATGGCATCCTGAACGTCTCAGCTGAAGACAAGACCACTGGACAGAAGAACAAGATCACTATTACC
AATGACAAGGGTAGGTTATCAAAGGAAGAAATTGAGAAGATGGTCCAGGAAGCAGAGAGGTACAAGGCAGAGGATGAAGAGCACAAGAAA
AAGGTTGAGGCCAAGAATGCACTTGAGAACTATGCCTACAACATGAGGAACACTATAAAGGATGATAAGATTAGTTCTAAGCTTAGTGCA
GACGACAAGAAAAAGATTGAGGATGCCATTGATCAGGCAATTTCATGGCTTGATAGCAACCAGCTTGCTGAAGCTGATGAGTTTGAAGAT
AAGATGAAGGAACTGGAGAGCCTATGTAATCCCATAATTGCAAAGATGTACCAGGGTGCTGGTGGTGAGGCAGGTGCACCTATGGATGAT
GATGATGCTCCTCCAGCTGGTTCTACCGGTGCAGGCCCCAAGATTGAGGAGGTCGATTAA
Edits in Original Sequence 
CTACTCTCTTCTTCTTTCTACCGCCGCCGTCTAGCATTCATTTGATACATTTTTTTTTGGTTTTTTTCCGTCGTC(5')ATGGCCGGGAA
AGGTGAAGGTCCGGCGATCGGTATAGATCTAGGAACTACTTACTCTTGCGTTGGAGTTTGGCAGCATGATCGTGTTGAGATTATTGCTAA
TGACCAAGGGAACAGGACGACTCCTTCTTACGTTGGTTTTACTGATTCTGAGCGTCTCATTGGCGATGCTGCTAAGAATCAAGTCGCCAT
GAATCCTATTAACACCGTGTTTGATGCCAAGCGTCTTATTGGAAGGAGGTTCAGTGATGCCTCTGTACAGAGTGACATCAAACTGTGGCC
TTTTAAGGTTACTCCTGGACCTGGTGACAAGCCAATGATTGTTGTTAACTACAAGGGAGAAGAGAAACAGTTTTCTGCTGAAGAAATCTC
TTCCATGGTTCTTATTAAGATGAAGGAAATTGCCGAGGCCTTCCTTGGGTCAACAGTGAAGAATGCTGTGGTTACTGTGCCTGCATACTT
CAATGACTCGCAACGTCAGGCTACTAAGGATGCTGGTGTCATATCTGGCTTGAATGTCATGCGTATTATTAATGAGCCCACAGCAGCTGC
CATTGCCTATGGTCTTGACAAAAAGGCCACTAGTGTTGGTGAGAAGAATGTTCTTATCTTTGATCTCGGTGGTGGTACCTTTGATGTGTC
CCTCCTCACTATTGAAGAGGGTATCTTTGAGGTGAAAGCCACAGCAGGAGACACTCACCTTGGTGGTGAAGATTTTGATAACAGAATGGT
GAACCACTTTGTCCAGGAATTTAAAAGAAAGCACAAGAAGGATATCACCGGTAACCCTAGGGCCCTTAGAAGATTGAGGACAGCTTGTGA
AAGAGCAAAAAGAACTCTTTCCTCCACTGCCCAGACAACAATCGAAATTGATTCCCTATATGAGGGAGTTGACTTCTATTCAACCATTAC
TCGTGCCAGATTTGAGGAGTTAAACATGGATCTTTTCAGGAAGTGTATGGAGCCTGTAGAGAAGTGTTTGAGGGATGCCAAGATGGACAA
GAGCTCTGTACACGATGTTGTTCTTGTTGGTGGTTCCACCAGAATTCCCAAGGTACAACAGCTGTTGCAAGACTTCTTTAATGGAAAGGA
GCTTTGCAAGAGTATCAACCCAGATGAGGCTGTTGCCTATGGTGCTGCTGTTCAAGCTGCTATTCTCAGTGGAGAGGGTAATGAGAAGGT
ACAAGACTTGTTGCTTTTGGATGTCACCCCTCTATCTCTTGGATTGGAAACTGCTGGAGGAGTCATGACTGTCTTGATTCCAAGGAATAC
CACCATTCCTACCAAGAAAGAGCAGGTGTTCTCTACCTATTCTGACAACCAGCCTGGAGTGTTGATTCAGGTTTACGAGGGTGAGAGAGC
AAGGACCAGAGACAACAACTTGTTGGGTAAATTTGAGCTCTCTGGTATTCCTCCTGCTCCTAGGGGTGTGCCTCAGATCACGGTCTGCTT
TGACATTGATGCCAATGGCATCCTGAACGTCTCAGCTGAAGACAAGACCACTGGACAGAAGAACAAGATCACTATTACCAATGACAAGGG
TAGGTTATCAAAGGAAGAAATTGAGAAGATGGTCCAGGAAGCAGAGAGGTACAAGGCAGAGGATGAAGAGCACAAGAAAAAGGTTGAGGC
CAAGAATGCACTTGAGAACTATGCCTACAACATGAGGAACACTATAAAGGATGATAAGATTAGTTCTAAGCTTAGTGCAGACGACAAGAA
AAAGATTGAGGATGCCATTGATCAGGCAATTTCATGGCTTGATAGCAACCAGCTTGCTGAAGCTGATGAGTTTGAAGATAAGATGAAGGA
ACTGGAGAGCCTATGTAATCCCATAATTGCAAAGATGTACCAGGGTGCTGGTGGTGAGGCAGGTGCACCTATGGATGATGATGATGCTCC
TCCAGCTGGTTCTACCGGTGCAGGCCCCAAGATTGAGGAGGTCGATTAA(3')GTGTGAACAGTTCTAGTTTTATTCTCAGTATAAACTA
TTCTATTATATTTGGTACTTTTTTATGTTTTTGCTATATCGGTTTCGTCTATTTATTAAGCTGTTGAATGTTGATGGCTCTTTATATGAG
TTCCATCGATTTTGAATTTTAAATGACTATCCGTTGTTTGGAAACTCTTAGGCTGAAATTGTCTTTACAAGTGCTCTTATCTGGCCTACG
ACTTTGTATTACTGGTCTATATTTTCCAAGTTAATACGGTGGAAAAGATATTTGAGAACAGCTTATATGGGAAAGAAAAAATTGTTACAA
CTTTTAAGTTTTTTTTTTTCCCAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan