ESTScan Details for Unigene SGN-U579887

Score 
891
Direction 
Forward
Predicted Peptide Sequence 
MVKCYPTVSEEYQKAVEKCKRKLRGLIAEKNCAPIMLRLAWHSAGTYDVKTKTGGPFGTIRHPNELKHGANNGLDIAVRLLEPIKEQFPI
LSYADFYQLAGVVAVEVTGGPDIPFHPGRQDKTEPPPEGRLPDATKGSDHLREVFGHMGLSDKDIVALSGGHTLGRCHKERSGFEGAWTN
NPLIFDNSYFKELLSGEKEGLLQLPSDKALLEDPVFRPLVEKYAADEDAFFADYAEAHLKLSELGFADAE*
Predicted Coding Sequence 
ATGGTGAAGTGTTATCCGACGGTGAGCGAAGAGTATCAAAAAGCAGTTGAAAAATGTAAGAGGAAGCTCAGAGGACTTATCGCCGAGAAG
AATTGTGCTCCGATTATGCTGAGATTAGCATGGCATTCAGCAGGGACATATGATGTCAAAACCAAAACTGGTGGTCCATTTGGAACAATC
AGGCACCCGAATGAACTTAAACATGGAGCTAACAATGGTCTTGATATTGCTGTTCGACTTTTGGAGCCGATCAAGGAACAGTTCCCAATC
CTATCCTACGCTGACTTTTATCAGTTGGCTGGAGTAGTTGCTGTTGAAGTTACGGGAGGCCCCGATATTCCTTTTCATCCTGGGAGACAG
GACAAGACAGAACCACCTCCAGAAGGCCGCTTGCCTGACGCCACCAAAGGCTCAGATCATCTGAGGGAGGTTTTTGGACACATGGGATTG
AGTGATAAAGACATTGTTGCTTTATCTGGTGGTCACACTCTGGGAAGGTGCCACAAAGAACGCTCAGGATTTGAGGGAGCATGGACCAAC
AACCCTCTCATATTTGACAATTCCTATTTCAAGGAGCTTTTGAGTGGAGAGAAAGAAGGTCTCCTCCAGCTACCATCAGACAAAGCACTC
TTAGAAGATCCAGTCTTCCGCCCTCTAGTCGAGAAATATGCTGCAGATGAAGATGCATTCTTTGCTGATTATGCTGAAGCTCATTTGAAG
CTCTCGGAGCTCGGATTTGCAGATGCTGAGTAA
Edits in Original Sequence 
GTTTTTGAATTTGAGCTAACTAATATATTTTGCTTTAAAAGATTTGGAAATCGACGTTTGATCGGAGAAGAA(5')ATGGTGAAGTGTTA
TCCGACGGTGAGCGAAGAGTATCAAAAAGCAGTTGAAAAATGTAAGAGGAAGCTCAGAGGACTTATCGCCGAGAAGAATTGTGCTCCGAT
TATGCTGAGATTAGCATGGCATTCAGCAGGGACATATGATGTCAAAACCAAAACTGGTGGTCCATTTGGAACAATCAGGCACCCGAATGA
ACTTAAACATGGAGCTAACAATGGTCTTGATATTGCTGTTCGACTTTTGGAGCCGATCAAGGAACAGTTCCCAATCCTATCCTACGCTGA
CTTTTATCAGTTGGCTGGAGTAGTTGCTGTTGAAGTTACGGGAGGCCCCGATATTCCTTTTCATCCTGGGAGACAGGACAAGACAGAACC
ACCTCCAGAAGGCCGCTTGCCTGACGCCACCAAAGGCTCAGATCATCTGAGGGAGGTTTTTGGACACATGGGATTGAGTGATAAAGACAT
TGTTGCTTTATCTGGTGGTCACACTCTGGGAAGGTGCCACAAAGAACGCTCAGGATTTGAGGGAGCATGGACCAACAACCCTCTCATATT
TGACAATTCCTATTTCAAGGAGCTTTTGAGTGGAGAGAAAGAAGGTCTCCTCCAGCTACCATCAGACAAAGCACTCTTAGAAGATCCAGT
CTTCCGCCCTCTAGTCGAGAAATATGCTGCAGATGAAGATGCATTCTTTGCTGATTATGCTGAAGCTCATTTGAAGCTCTCGGAGCTCGG
ATTTGCAGATGCTGAGTAA(3')GGTGTGGTGAGAAAGTTGTTTCAATAATCTCTGGAGATCAGTCTGGTTCTTCCAATTTTTCATTTGT
ACTATTTGTGTATTTAAAACTTTAAAAGTCTAAAAACCAGCTTTACATATATTATATGATTGAAGAATATTGTATGGCTATTACATAAGT
CTTGTAATAATGCAACTTTTGTGTCTTTATGTTTGTTGCTAGTATATACAATATATTAAGTAAGGGTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan