ESTScan Details for Unigene SGN-U579891

Score 
431
Direction 
Forward
Predicted Peptide Sequence 
XGRGQQKKHKSSVAMAKRLIPTLNRVLIEKITAPAKTSAGILLPENSSKLNSGKVVAVGPGLHDKTGNLIPTAVKEGDTVLLPEYGGTQV
KLGEKEFHLYRDEDILGTLHDXSTTAFEXFIDVHVVEVFIQWEVNFKDVFGFSIRIVLD*
Predicted Coding Sequence 
XTTGGCCGGGGACAGCAGAAAAAGCATAAATCTTCAGTAGCCATGGCGAAACGTTTGATCCCAACACTTAACAGGGTTTTGATCGAGAAA
ATTACAGCTCCTGCTAAAACAAGTGCTGGTATTCTTCTCCCTGAGAATTCATCTAAGCTGAATTCAGGGAAAGTAGTGGCTGTTGGACCA
GGACTTCATGACAAGACAGGGAACTTGATACCTACTGCTGTCAAGGAAGGTGACACCGTCTTGTTGCCTGAGTACGGTGGTACTCAAGTC
AAGTTGGGGGAGAAAGAATTTCATTTGTACCGGGATGAAGACATTTTAGGGACACTGCACGACXTGAGCACCACCGCGTTTGAGXTTTTC
ATTGACGTTCATGTTGTTGAGGTTTTTATTCAATGGGAGGTTAATTTCAAGGATGTTTTTGGTTTTAGCATTCGAATTGTGCTTGATTGA
Edits in Original Sequence 
(5')XTTGGCCGGGGACAGCAGAAAAAGCATAAATCTTCAGTAGCCATGGCGAAACGTTTGATCCCAACACTTAACAGGGTTTTGATCGA
GAAAATTACAGCTCCTGCTAAAACAAGTGCTGGTATTCTTCTCCCTGAGAATTCATCTAAGCTGAATTCAGGGAAAGTAGTGGCTGTTGG
ACCAGGACTTCATGACAAGACAGGGAACTTGATACCTACTGCTGTCAAGGAAGGTGACACCGTCTTGTTGCCTGAGTACGGTGGTACTCA
AGTCAAGTTGGGGGAGAAAGAATTTCATTTGTACCGGGATGAAGACATTTTAGGGACACTGCACGACXTGAGCACCACCGCGTTTGAGXT
TTTCATTGACGTTCATGTTGTTGAGGTTTTTATTCAATGGGAGGTTAATTTCAAGGATGTTTTTGGTTTTAGCATTCGAATTGTGCTTGA
TTGA(3')TATCTAATGCAATGATAGTTGAATAACTCCATTCGAATTGTGTTTGATTGATATCTAATGCAATCATAGTTGAACAACTCCA
TTCCAATTGTGTTTGATTGATATCTAATGCAATGATAGTTGAATAACTCCATTCCAATTGTAAGTGATTTGATATCTAATGCAATGATAG
TTGAATAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan