ESTScan Details for Unigene SGN-U579951

Score 
942
Direction 
Forward
Predicted Peptide Sequence 
XGPGIPHTHKKSSAALSLEGVFFSYFXTMALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKI
RFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEI
SAKSNYNFEKPFLYLARKLAGDGNLHFVESPALAPPEVQIDLAAQALHEQELQAALNQPLPDDDDEAFE*
Predicted Coding Sequence 
XXCGGGCCGGGGATTCCTCACACACACAAAAAAAGCTCTGCCGCTCTCTCTCTTGAAGGAGTTTTCTTCTCATACTTTCXGACAATGGCT
TTACCAAACCAACAAACTGTAGATTATCCAAGCTTCAAGCTTGTTATTGTGGGGGATGGAGGAACTGGGAAGACAACTTTTGTCAAAAGG
CATCTCACTGGTGAATTCGAGAAAAAATATGAACCCACTATTGGTGTGGAGGTTCATCCACTAGACTTCTTCACAAATTGTGGGAAAATT
CGCTTTTATTGCTGGGATACAGCCGGACAAGAGAAGTTTGGAGGTCTCAGAGATGGTTACTACATTCATGGGCAATGTGCAATTATCATG
TTTGATGTTACAGCCCGTCTGACCTACAAGAATGTTCCTACTTGGCATAGAGATCTTTGCAGGGTTTGTGAAAACATCCCCATTGTTCTC
TGTGGAAACAAAGTTGATGTCAAGAACAGGCAGGTTAAGGCAAAGCAAGTTACCTTCCACAGGAAGAAAAATTTGCAGTACTATGAGATC
TCGGCAAAGAGTAACTATAACTTTGAGAAGCCTTTTCTGTACCTTGCTAGAAAGCTTGCTGGGGATGGTAATCTTCACTTTGTGGAATCA
CCTGCACTTGCTCCCCCAGAAGTACAAATTGACTTAGCTGCACAGGCCCTGCACGAACAGGAGCTTCAAGCAGCCCTTAATCAGCCACTT
CCAGATGACGATGATGAAGCATTTGAATAG
Edits in Original Sequence 
(5')XXCGGGCCGGGGATTCCTCACACACACAAAAAAAGCTCTGCCGCTCTCTCTCTTGAAGGAGTTTTCTTCTCATACTTTCXGACAAT
GGCTTTACCAAACCAACAAACTGTAGATTATCCAAGCTTCAAGCTTGTTATTGTGGGGGATGGAGGAACTGGGAAGACAACTTTTGTCAA
AAGGCATCTCACTGGTGAATTCGAGAAAAAATATGAACCCACTATTGGTGTGGAGGTTCATCCACTAGACTTCTTCACAAATTGTGGGAA
AATTCGCTTTTATTGCTGGGATACAGCCGGACAAGAGAAGTTTGGAGGTCTCAGAGATGGTTACTACATTCATGGGCAATGTGCAATTAT
CATGTTTGATGTTACAGCCCGTCTGACCTACAAGAATGTTCCTACTTGGCATAGAGATCTTTGCAGGGTTTGTGAAAACATCCCCATTGT
TCTCTGTGGAAACAAAGTTGATGTCAAGAACAGGCAGGTTAAGGCAAAGCAAGTTACCTTCCACAGGAAGAAAAATTTGCAGTACTATGA
GATCTCGGCAAAGAGTAACTATAACTTTGAGAAGCCTTTTCTGTACCTTGCTAGAAAGCTTGCTGGGGATGGTAATCTTCACTTTGTGGA
ATCACCTGCACTTGCTCCCCCAGAAGTACAAATTGACTTAGCTGCACAGGCCCTGCACGAACAGGAGCTTCAAGCAGCCCTTAATCAGCC
ACTTCCAGATGACGATGATGAAGCATTTGAATAG(3')ATGGCATAGCTCAGAGCAGATCAGTTTCACTGTTGCACCTTTCCATATTCCT
AGTCCTTCAATTTTCTCTATTTGGGCTTTTTTTGTCTTTGTTGTTTGAGGATGTATTTGCTGCTTCCTTGTATTATTGATTGGTTAGTAG
ATGTATTCGTCTGGGGCCATGAGGTTTTGTTTTGTTAGGTTAGATATTCCCATCCTGATATATGGGCGCACATTGTCGAGGCTCTGTTTT
GAGCTTGTTATAATATTACTTGGTCTCATATTCGACAGTAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan