ESTScan Details for Unigene SGN-U579998

Score 
1634
Direction 
Forward
Predicted Peptide Sequence 
XHSPSSLTPKXPNLLDEDSYLLKDVWESTEEDDNTKYYEILGVPNTASPDDLKKAYRKAAIKNHPDKGGDPEKFKEIAQAYEVLNDPEKR
EIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGGGFGGGGSSRGRRQRRGEDVVHPLKVSLEDLYNGISKKLSLSRNVLCSKCKGVGSK
SGASLKCPGCQGKGMKVSIRQLGPMIQQMQHPCNECRGTGEKINDKDRCPQCKGEKVVQEKKVLEVVVDKGMQNGQKITFPGEADEEPDT
VTGDIVFILQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQFVLTHLDNRQLIIKSQPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHF
TVDFPNTLTPELCKNLEAVLPARPKTQASDMELDECEETTLHDVNIDEEMRRKQQQQAQEAYDEDDDDMHGGAQRVQCAQQ*
Predicted Coding Sequence 
XCTCATTCTCCTTCTTCTCTAACACCTAAAGAXCCTAATCTTCTCGACGAAGATTCCTATCTGTTGAAAGATGTTTGGGAGAGCACCGAA
GAAGATGATAACACTAAGTACTATGAGATCTTGGGAGTGCCTAATACTGCTTCACCAGATGATTTGAAGAAAGCTTATCGTAAAGCTGCT
ATTAAGAATCATCCTGATAAGGGTGGTGATCCTGAAAAATTCAAGGAGATTGCCCAAGCCTATGAGGTCTTGAATGACCCTGAGAAACGT
GAGATCTATGATCAGTATGGTGAAGATGCTCTCAAGGAAGGAATGGGTGGTGGAGGTGGTGGACATGACCCGTTTGACATATTCCAGTCA
TTCTTTGGTGGAGGCGGGTTTGGTGGTGGTGGAAGCAGCAGAGGAAGAAGGCAAAGGAGAGGGGAGGATGTTGTCCACCCTCTCAAGGTC
TCTTTGGAGGATCTTTACAATGGAATATCAAAGAAGCTATCACTATCTCGCAATGTGTTGTGCTCAAAGTGCAAGGGGGTAGGGTCTAAA
TCAGGTGCTTCATTGAAATGTCCTGGATGTCAAGGGAAAGGAATGAAAGTTTCAATCAGACAACTTGGCCCCATGATCCAGCAGATGCAG
CACCCATGTAATGAGTGTAGGGGTACTGGTGAGAAAATAAACGATAAAGACAGGTGTCCACAGTGCAAGGGCGAGAAAGTTGTGCAGGAG
AAGAAGGTGTTGGAAGTTGTTGTGGATAAGGGTATGCAAAATGGACAAAAGATAACATTTCCAGGAGAGGCTGATGAGGAGCCTGATACT
GTCACTGGAGACATTGTTTTTATCTTGCAACAGAAGGAACATCCCAAGTTTAAGCGAAAGGGAGATGATCTCTTTGTAGAACACACCTTG
ACCTTGACTGAGGCTCTCTGTGGTTTTCAGTTTGTCTTGACTCACCTAGATAATAGACAGCTGATAATCAAGTCCCAACCTGGAGAAGTT
GTCAAGCCTGATCAATTTAAGGCCATAAATGATGAAGGCATGCCAATGTACCAAAGGCCATTCATGAAAGGTAAACTGTACATTCACTTC
ACCGTGGACTTCCCCAACACATTAACCCCAGAGTTGTGCAAGAATCTTGAAGCAGTGCTGCCAGCAAGGCCTAAAACACAAGCGTCCGAT
ATGGAATTGGACGAGTGCGAGGAAACCACCTTGCATGACGTGAACATTGATGAGGAGATGCGTAGGAAGCAGCAGCAACAGGCCCAAGAG
GCATATGACGAAGATGACGACGATATGCATGGTGGTGCACAGAGAGTGCAATGTGCACAACAGTAA
Edits in Original Sequence 
(5')XCTCATTCTCCTTCTTCTCTAACACCTAAAGAXCCTAATCTTCTCGACGAAGATTCCTATCTGTTGAAAGATGTTTGGGAGAGCAC
CGAAGAAGAgTGATAACACTAAGTACTATGAGATCTTGGGAGTGCCTAATACTGCTTCACCAGATGATTTGAAGAAAGCTTATCGTAAAG
CTGCTATTAAGAATCATCCTGATAAGGGTGGTGATCCTGAAAAATTCAAGGAGATTGCCCAAGCCTATGAGGTCTTGAATGACCCTGAGA
AACGTGAGATCTATGATCAGTATGGTGAAGATGCTCTCAAGGAAGGAATGGGTGGTGGAGGTGGTGGACATGACCCGTTTGACATATTCC
AGTCATTCTTTGGTGGAGGCGGGTTTGGTGGTGGTGGAAGCAGCAGAGGAAGAAGGCAAAGGAGAGGGGAGGATGTTGTCCACCCTCTCA
AGGTCTCTTTGGAGGATCTTTACAATGGAATATCAAAGAAGCTATCACTATCTCGCAATGTGTTGTGCTCAAAGTGCAAGGGGGTAGGGT
CTAAATCAGGTGCTTCATTGAAATGTCCTGGATGTCAAGGGAAAGGAATGAAAGTTTCAATCAGACAACTTGGCCCCATGATCCAGCAGA
TGCAGCACCCATGTAATGAGTGTAGGGGTACTGGTGAGAAAATAAACGATAAAGACAGGTGTCCACAGTGCAAGGGCGAGAAAGTTGTGC
AGGAGAAGAAGGTGTTGGAAGTTGTTGTGGATAAGGGTATGCAAAATGGACAAAAGATAACATTTCCAGGAGAGGCTGATGAGGAGCCTG
ATACTGTCACTGGAGACATTGTTTTTATCTTGCAACAGAAGGAACATCCCAAGTTTAAGCGAAAGGGAGATGATCTCTTTGTAGAACACA
CCTTGACCTTGACTGAGGCTCTCTGTGGTTTTCAGTTTGTCTTGACTCACCTAGATAATAGACAGCTGATAATCAAGTCCCAACCTGGAG
AAGTTGTCAAGCCTGATCAATTTAAGGCCATAAATGATGAAGGCATGCCAATGTACCAAAGGCCATTCATGAAAGGTAAACTGTACATTC
ACTTCACCGTGGACTTCCCCAACACATTAACCCCAGAGTTGTGCAAGAATCTTGAAGCAGTGCTGCCAGCAAGGCCTAAAACACAAGCGT
CCGATATGGAATTGGACGAGTGCGAGGAAACCACCTTGCATGACGTGAACATTGATGAGGAGATGCGTAGGAAGCAGCAGCAACAGGCCC
AAGAGGCATATGACGAAGATGACGACGATATGCATGGTGGTGCACAGAGAGTGCAATGTGCACAACAGTAA(3')TTTGATACTCTCTTT
TTCGGTAGATAGCAGTACTTAATTTCGTCAAGTATATCAATCTCCCTGTTCTTGGGTTTGATAATAGGGCTGATATAAGAATTGACAGTC
AGGAACAACATTGCTCTAGTAGGAGATATAGATTATTACTATTGACTTTGAAATTTTATTTATGCATAAAACTGTGAGCAAAATTTTGTG
ACCTGGGATTATTAGATGTTGTGTTATTGTATCTGTCTTCAGGAGCCCCAAATTACCTATCGAGGAACCGAGGCTTGCGGTAGTAATACA
AGAAAAATCTACTCTCTACTATATATATGGTTGCAGGGGCATAGCTAGACCACCTATGGTGGCCAATTAGACACCATTCGTTAAAAAATT
TCGATATATATGTGAATATTTGATCCTTTAGTGTAATGTCAATAGTGTCCATTTGAATGAATGAATTTCAGATCGAACTTCAAATATCAA
AATTCATTTTCTCAATTTTAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan