ESTScan Details for Unigene SGN-U580044

Score 
306
Direction 
Forward
Predicted Peptide Sequence 
EVLKSHGLPMGLLPKGVRNFTLDNSGNFVVHLDQPCNSKFEKKENELHYERNVSGRLSLGQIDLISGISAKDLFLWFQVKKIYVSSSSSG
VIYFDVGVVSKQFSLSSFDNPKECTAVQVTDLEDAKQDSKSLSGNIRYKLDQGNIGSAIL*
Predicted Coding Sequence 
GAAGTTCTTAAATCCCATGGATTGCCAATGGGATTATTACCAAAGGGTGTGAGGAATTTCACTTTAGATAATTCTGGGAATTTTGTGGTT
CATTTAGATCAACCTTGTAATTCAAAATTTGAGAAAAAAGAAAATGAATTGCACTATGAAAGGAATGTTTCAGGGAGGTTGAGTTTAGGT
CAGATTGATTTGATTTCTGGGATTTCTGCTAAAGATTTGTTTTTGTGGTTTCAAGTTAAGAAAATTTATGTGTCATCTTCAAGTTCTGGG
GTCATTTATTTTGATGTTGGAGTTGTTTCTAAGCAGTTTTCATTGTCTTCATTTGATAATCCGAAGGAATGTACTGCTGTTCAGGTTACA
GATCTTGAAGATGCCAAACAGGACTCAAAGAGTCTATCCGGGAACATTCGATACAAGCTTGATCAGGGGAATATTGGCAGTGCGATTTTG
TAG
Edits in Original Sequence 
GCTTGCCTCTAAGCTTCTTCTTGTTCTTCATGTTCTTATTCTCCTCCACCATCATATCAACAAAAAAAAAATCCCACTTTTTAAAACCCC
AAATTCATAAATTTTTCGAAACCCCAAATCTTTTTTTTCACTCTTTCTATGCTCTAACAAAAAAAAAAGACATCTTTTTTGGTATAATAC
ACCAAAATGTTGGTTCTTGGAAATTCCTTTGTGATATTTACATTTGTTTTGTGTTCTATATGTGTATTTACATCAGCAGATTCATCTATA
TAT
(5')GAAGTTCTTAAATCCCATGGATTGCCAATGGGATTATTACCAAAGGGTGTGAGGAATTTCACTTTAGATAATTCTGGGAATTT
TGTGGTTCATTTAGATCAACCTTGTAATTCAAAATTTGAGAAAAAAGAAAATGAATTGCACTATGAAAGGAATGTTTCAGGGAGGTTGAG
TTTAGGTCAGATTGATTTGATTTCTGGGATTTCTGCTAAAGATTTGTTTTTGTGGTTTCAAGTTAAGAAAATTTATGTGTCATCTTCAAG
TTCTGGGGTCATTTATTTTGATGTTGGAGTTGTTTCTAAGCAGTTTTCATTGTCTTCATTTGATAATCCGAAGGAATGTACTGCTGTTCA
GGTTACAGATCTTGAAGATGCCAAACAGGACTCAAAGAGTCTATCCGGGAACATTCGATACAAGCTTGATCAGGGGAATATTGGCAGTGC
GATTTTGTAG(3')AATATTGCAGTTCAAAATTTGGTTACAGAGTTGTTTGCACATAGCTCAATCAAGTCCTTTGGATGGTCTTTATCAT
TCCTTGTATGTAAATTGTCTGCAGAGTTTGGAAACAAATTGTGCTATACTGGTTTGCATTTTCTTGTCTAGTAAAGACAATCGCGAATTC
AGAATCTAGAGTCAGTGAAGTCGGAAAATCGAAATATTAGAAATTGGAATCAAGAAAAGGGGGTAACCAAGTAAGATATTGATATGCCAA
ATTGGTTGGAGGTTTGGAGGGGTATAGGGATACAGGTTCATCTGTTCAAAAAAATGTTGAAATTTCTCAGAGAAGGTTTATTTCTTTTTT
GTTGGATTCATTTATGGACATAGTCATGGTTATGGAATTTAAAGCAAATTACTTCTTTTTTTTTTTTGTAGTTGCAGGCATAGAATATGA
AATAATGAAATAAATTTGCCTTTTCCTTTCTTGTACTATTTGTTGTCATTGTATTTTGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan