Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U580097

Score 
363
Direction 
Forward
Predicted Peptide Sequence 
XVVNHGIPTSVLDRTLQGTRQFFEQDNEVKKQYYTRDTAKKVVYTSNLDLYKSSGPAASWRDTIFCYMAPNPPSLQEFPTPCGESLIDFS
KDVKKLGFTLLELLSEGLGLDRSYLKDYMDCFHLFCSCNYYPPCPQPELTMGTIQHTDIGFVTILLQDDMGGLQVLHQNHWVDVPPTPGS
XSGEYWRFSAENLFFNYFLQLLSNDKYLSVEHRAISNNVGSRMSITCFFGESPYQSSKLYGPITELLSEDNPPKYRANHSERPH*
Predicted Coding Sequence 
XXGGTGGTTAATCATGGGATTCCAACATCCGTCTTGGACAGAACGTTGCAAGGAACACGACAGTTCTTTGAGCAAGATAACGAGGTTAAG
AAACAGTATTACACTCGAGATACTGCGAAAAAAGTGGTTTATACTAGCAATCTTGATTTGTATAAATCTTCTGGTCCAGCTGCAAGTTGG
AGAGACACGATTTTCTGTTACATGGCTCCGAATCCTCCCAGTCTACAAGAATTTCCAACTCCATGCGGGGAGTCATTAATAGACTTCTCC
AAGGATGTGAAGAAACTGGGATTCACTTTACTTGAATTATTGTCTGAAGGTCTCGGTCTCGATCGTAGTTATCTCAAAGATTATATGGAT
TGTTTTCATCTTTTCTGTTCTTGCAACTACTACCCACCATGTCCTCAGCCAGAACTCACCATGGGCACCATTCAACATACCGATATTGGT
TTTGTAACGATCCTTCTACAAGATGATATGGGAGGGCTCCAAGTTCTTCACCAGAATCATTGGGTTGATGTTCCTCCTACACCCGGTTCT
XCTAGTGGTGAATATTGGAGATTTTCTGCAGAAAATCTTTTTTTTAATTATTTTTTGCAGCTCTTGTCAAATGACAAGTACTTAAGTGTC
GAGCACAGAGCAATCTCAAACAATGTTGGATCAAGAATGTCAATCACGTGCTTCTTCGGTGAAAGTCCATATCAATCTTCCAAGCTTTAT
GGACCGATAACTGAATTGTTATCAGAAGATAATCCTCCAAAATATCGCGCXAACCACAGTGAAAGACCACACTAG
Edits in Original Sequence 
(5')XXGGTGGTTAATCATGGGATTCCAACATCCGTCTTGGACAGAACGTTGCAAGGAACACGACAGTTCTTTGAGCAAGATAACGAGGT
TAAGAAACAGTATTACACTCGAGATACTGCGAAAAAAGTGGTTTATACTAGCAATCTTGATTTGTATAAATCTTCTGGTCCAGCTGCAAG
TTGGAGAGACACGATTTTCTGTTACATGGCTCCGAATCCTCCCAGTCTACAAGAATTTCCAACTCCATGCGGGGAGTCATTAATAGACTT
CTCCAAGGATGTGAAGAAACTGGGATTCACTTTACTTGAATTATTGTCTGAAGGTCTCGGTCTCGATCGTAGTTATCTCAAAGATTATAT
GGATTGTTTTCATCTTTTCTGTTCTTGCAACTACTACCCACCATGTCCTCAGCCAGAACTCACCATGGGCACCATTCAACATACCGATAT
TGGTTTTGTAACGATCCTTCTACAAGATGATATGGGAGGGCTCCAAGTTCTTCACCAGAATCATTGGGTTGATGTTCCTCCTACACCCGG
TTCTXCTAGTGGTGAATATTGGAGATTTTCTGCAGAAAATCTTTTTTTTAATTATTTTTTGCAGCTCTTGTCAAATGACAAGTACTTAAG
TGTCGAGCACAGAGCAATCTCAAACAATGTTGGATCAAGAATGTCAATCACGTGCTTCTTCGGTGAAAGTCCATATCAATCTTCCAAGCT
TTATGGACCGATAACTGAATTGTTATCAGAAGATAATCCTCCAAAATATCGCGCXAACCACAGTGAAAGACCACACTAG(3')TTACCTC
CATAACAGAGGCCTAGATGGAACTTCTGCATTGTCCCGTTACAAGATCTAAGAATAAGAATAATAATGTTATCTATTATTACTATTTATA
CTTCTGCAGATTGTACCTTTGAATTTGAAGCAAATGTTTGAGTTAAATACTTTCACGTTTCTAAGCAATGTAATATAATTTATAAAGTAT
GTGCTTGCTAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan