ESTScan Details for Unigene SGN-U580153

Score 
485
Direction 
Forward
Predicted Peptide Sequence 
MAPGGRIFKQTTLTGETIQATDNXDESNNITPVVVTESGNVVARLEEKXLEKMKKSMRGKMKIEISVGKGSPTKPTQSEKLSNELGVIAR
NFLPLPNKWKELAREDRDAALIRCLERFEINLDEHYVKDSCEDILKNXKSTMALQVKTIIESARSEEEARKIEVSELIPENGTGFVTRRS
IQSIRNDADINKVNRTKLKSNHLMGSKAFVAARAEMGETNPERVEPEESSFISILITLKEKEWSSQETETNYNNMKDLKDLYSSGESSMT
IDEIVDTVLGTKSGYIKGLGYGPKSNTTIATQRRTAELEDLKKAKEEADTIQYNLKKRLNTAETIVEYQQSQMQDQQSQIQALNSQMDIV
MACQQEMFKKMQFLGAHRHQG*
Predicted Coding Sequence 
ATGGCACCGGGTGGACGTATCTTCAAGCAGACTACACTTACAGGGGAAACTATTCAAGCTACTGATAACCAXGATGAATCGAATAACATT
ACCCCTGTTGTTGTTACAGAATCAGGAAATGTCGTGGCAAGACTAGAGGAAAAGGXTCTTGAAAAAATGAAGAAGTCTATGAGAGGCAAG
ATGAAGATCGAGATATCAGTTGGTAAGGGAAGTCCAACTAAACCAACTCAATCAGAAAAACTATCCAATGAGTTGGGCGTAATTGCCCGG
AATTTTCTTCCGCTTCCAAATAAGTGGAAGGAACTCGCAAGAGAGGACAGAGATGCAGCACTTATTAGATGCCTGGAGAGATTTGAGATT
AATTTAGACGAGCATTACGTGAAAGATAGCTGTGAGGATATTCTGAAAAATAXGAAGTCGACAATGGCGCTACAAGTTAAAACAATTATT
GAAAGTGCACGCTCCGAGGAAGAAGCTCGTAAAATTGAAGTGTCAGAGTTGATCCCTGAAAATGGAACAGGCTTTGTGACGCGTAGATCA
ATCCAGAGCATAAGAAACGATGCXGACATAAATAAGGTGAATCGAACTAAGCTTAAATCTAATCATTTAATGGGGTCAAAGGCTTTTGTA
GCTGCTCGTGCTGAAATGGGTGAAACAAACCCTGAAAGAGTGGAGCCTGAAGAATCGAGTTTTATAAGCATACTTATTACTCTTAAGGAA
AAAGAATGGTCATCTCAAGAGACTGAGACTAACTATAACAACATGAAAGATTTGAAAGATCTATATAGTTCAGGAGAGTCTTCTATGACT
ATTGATGAAATCGTGGATACTGTACTTGGTACAAAATCGGGATACATAAAAGGTCTCGGTTATGGTCCAAAATCTAATACTACAATAGCT
ACACAAAGGAGAACTGCAGAGCTGGAAGACCTCAAAAAGGCAAAAGAGGAAGCTGATACGATCCAATATAATTTAAAGAAACGACTAAAT
ACAGCTGAAACTATTGTTGAGTATCAGCAGTCTCAAATGCAAGACCAACAATCTCAGATACAAGCATTAAATTCTCAAATGGACATTGTA
ATGGCATGCCAACAGGAAATGTTTAAGAAAATGCAATTTCTTGGTGCTCATCGCCATCAAGGTTAG
Edits in Original Sequence 
CCAGCTAATTTTTTTCATCTCTTCTTCTACTTTCTCAGGATTGCTCTCCTCAACTCTTTTTTTTGTAATTTCATTCTAATTTTGCACATT
TTTCCACCTTAGGTGTAATAACTAGTCATCTAAACGGTAGATATTAACTTTTTAGATTGAGTTTAATTTTTAGTGTTGAAGAACATGATT
TGAGTGATCAAGCTCAGATCCATGCTTAAATTGAGTGAATTTAAGATTTCTCTGTTTTGTGTTTTTGTGAATATGAACAAAACACACCGT
TTCTCCTCATCTTCATGTAGAGATGCTTCAGATCCAATATCACATAAATGAATCTTTGCATGTCAGCTCAGATACCATTGTTGATGTCTT
CGCCAGCTATCCTACTCTAGTTAGCTTGTTTAGCAACATAATCGTAGCTGATGGAAGACTAAACAGGATAATCAAGCAGAAGTACCAGAC
CAAGGATCTTGGGTTTCTGCTGATGGAAACATGATATTTATCTTTCATTACTAACTGATTCTGAAATACCGTCTGTGTTATACATTAACT
ACTACCTATGCTATATGACATACAGTTATTATGAGCTTGGCTATGTTATGCCACTTGAAGGTTGGATAGTAGTTGAAATTCTCCAGCAAT
GTTATTGTGTATGTCTTGAGTGCCTTTCTAAAATGAACCTCTTGGACGATTTGCTTCAGTATTGCATCTGGTAGAGTTACCTTGTCATGA
AAATGTTAAGAGTATCTTTCTCTCTATAGGAAGTATACAGTAGCAACCATTGTCATCCTAAGACCTCATCCCTTGGACGTTTCCCTTTTG
CATGATGACTAGCCCATTGCATCTGGTGAATTTTTCCTGTCATGAAAATGTGTGAAGTTTCTTTCTCTCCATAGGTAGTATATAGTAGCT
ACCAGTGTCATCCTAATGACCTCATCCCTTGGACGTCTCCCTTTTGCATGATGACTAGCCCATTGCAGTTCATACACCCATGGACACATT
GCTACCTTAGGATCTTCCTTCATATTAATTGTGCTTCTAAGCAAGTGAAGAACAAGTTGGAGAGGCTCTCATCCTCCGGTCTTCATAGTT
GGTACACATATTCTTTGTATACAACTAGTCATATCAACCAGTCTAAAAATAAATAGCCATTTAGAATGACCAAGGTTATTGCATATTAGT
TTTTTCTAGGTCCATATTTATAAGCACCCCTTTGTCTCAAGTATAACTGCTTTATGGAGAATTTGTGAGTGTGAATACATGATACTGGAG
TTTGTTAAATGATGCTTCTTGAACCTGTTTCTTAGAATTAGGATAGGGTGGAACTTTGAATTAAGTTAAACTGAATCAAAACCATTTGAA
ATGAATATTTTGTAGGGCAATTAAAAAAAATCTGAGACAAACAATCATTTCTTCATGAGGCGCTATATCTGTTAGATCCAAAGCCTTTTC
TTAACACCTTTTCTTATATAAGTTTATAGAAAAGTTTTTGTGCCTTCAAATTTGGACATTTCTTGCATTAAGTTCTCTTTCATATGTTAT
ACTGGTTCTTTAATCTATAGTGATGCTTCAAATTGTTCAAGTAATATCATGACAAGAAGATAGTGAACTCTTATTTATAAATGTCGTGCG
TGAAACTTTCCAGATTGTTAGCCTTTGTTCTTTTCAGATTGTTCTTTAGTTGTCAATGATTGGTATTTTTATTAAACCAATTGAGTTGAT
ATTCTTATGAACTTACTAAATAACAGATGGAAGACTAAACAGAATTTTGCAAATCA
(5')ATGGCACCGGGTGGACGTATCTTCAAGCAG
ACTACACTTACAGGGGAAACTATTCAAGCTACTGaATAACCAXGATGAATCGAATAACATTACCCCTGTTGTTGTTACAGAATCAGGAAA
TGTCGTGGCAAGACTAGAGGAAAAGGXTCTTGAAAAAATGAAGAAGTCTATGAGAGGCAAGATGAAGATCGAGATATCAGTTGGTAAGGG
AAGTCCAACTAAACCAACTCAATCAGaAAAAACTATCCAATGAGTTGGGCGTAATTGCCCGGAATTTTCTTCCGCTTCCAAATAAGTGGA
AGGAACTCGCAAGAGAGGACAGAGATGCAGCACTTATTAGATGCCTGGAGAGATTTGAGATTAATTTAGACGAGCATTACGTGAAAGATA
GCTGTGAGGATATTCTGAAAAATAXGAAGTCGACAATGGCGCTACAAGTTAAAACAATTATTGAAAGTGCACGCTCCGAGGAAGAAGCTC
GTAAAATTGAAGTGTCAGAGTTGATCCCTGAAAAtTGGAACAGGCTTTGTGACGCGTAGATCAATCCAGAGCATAAGAAACGATGCXGAC
ATAAATAAGGTGAATCGAACTAAGCTTAAATCTAATCATTTAATGGGGTCAAAGGCTTTTGTAGCTGCTCGTGCTGAAATGGGTGAAACA
AACCCTGAAAGAGTGGAGCCTGAcAGAATCGAGTTTTATAAGCATACTTATTACTCTTAAGGAAAAAGAATGGTCATCTCAAGAGACTGA
GACTAACTATAACAACATGAAAGATTTGAAAGATCTATATAGTTCAGGAGAGTCTTCTATGACTATTGATGAAATCGTGGATACTGTACT
TGGTACAAAATCGGGATACATAAAAGGTCTCGGTTATGGTCCAAAATCTAATACTACAATAGCTACACAAAGGAGAACTGCAGAGCTGGA
AGACtCTCAAAAAGGCAAAAGAGGAAGCTGATACGATCCAATATAATTTAAAGAAACGACTAAATACAGCTGAAACTATTGTTGAGTATC
AGCAGTCTCAAATGCAAGACCAACAATCTCAGATACAAGCATTAAATTCTCAAATGGACATTGTAATGGCATGCCAACAGGAAATGTTTA
AGAAAATGCAATTTCTTGGTcGCTCATCGCCATCAAGGTTAG(3')AAGCAATATATACTTATATTATAAGTTCTATTTAATTACTTTTT
ATTAAATATGTAAATATGTAGCATTTAGTATCTAACATTGTATATTTTATATTTCTTATGATGCAGTGGACATTGAGCTCATCAGAATGC
CTACTTAAGTATATTTCTATTTTTATTTTGCCAACTTAAGTTTCATGTCTGACAAGTTGTAGTTTAAATAAATTATATTTTGTTTATATT
ACATAATATATAAGTTGATAGCTTCCTCCTAAAAATTAGTATTGAACATGCATATTGCCTTAACGTCAGTTGCTTCCTAAGCTTATTAGA
CAGGTTGTAGAAAAAATTATCAGACATTATAAATGGGGAACATTAAATTTCAGTAGCTAAGTAGATATAAAGATGAGATGTCCATCTTAT
TACAAAAAAATTGTGGATTTTAAGACATGGGAAATAGGATATCAACATTGTAGAGCTTCAATTGCTATCCTTGCTAATGTCTTACTCCAT
GTTTCTGATTTTAAAATGATAATGTTATATTGTTCGTGTTGCTTTGCTGAGTACTTTCTATTTTGTATGTCGTGCTAAGAGTGAAATATG
ATATGAACGTGATAACTAAGAGCTACCTTTTACTGTTATGCAACATGTAAAAAATTATATTACAGTAAACCTATTGACAGAATTAGTGAA
GTCTTGTGTCTCCAAACTAAGTGAAACATATTTGAGTGAACAACTTCATCTTTTTCCTTTATCTAACATGCATATGACTTGTGTGAAACT
GCACACCAGGTTTGCAATTCACATCCATCTTTCTACCTGATTTAATTTCTTAGATAATTGCAATCTTTGGTAACACTTTCCCTCGGTATT
ATCCAACACATAGTTGTTATGATATTTACCGAGTATTTCACTTAACTTGCTCCCTATCGTCCATAGCTGAGGAAATCATAGCATGCTCTG
TTAACTGAGTTAATTTTTTCTTGGGGATGAGCTTGTCATTCATAGGAGTAATCTGGAAATAAAAACTTTGAATAGGACAAAATGTCATAG
TTGGTGGTCCTCAAAGATATCAATATGTATGAGATATTAAATTCACTGATGTGGCTTTGTTTAGTGGCTTCTTTTTTTAAAAAAGGAACT
TCAAAATTTAACAATTATAACAATACCAAACATAAATCCTCAAAGATGCTAAATCCATGAATAGCAGATGCTATAATGCCTTGGATGCCT
TTGTATTATGTATAATTTGTTTTGTAGATCTTATAAATCTGAGAATTACTACATATGGAAGACATAAACTGTATTGCATATTCTACTTTT
TGACCTTAGTATGAATATATTAAGTCCAATCTTAATTTTGTTTCCTCTCTTTTTACACAGGTATAACAGGGGAAATGTCACCATAGTATT
GGTACTTTGGAAGAAATTGCTTCTTATTTGTCATAATTGGGAGTAATATTTAGTAGATTTCAGTTAGTTTATCTTGTTATTGGACACATT
CTATTTCCCCTTTAGGAACTTCTAATGTTTAGTTCTTTTAAATTATATGATCATGGATGAATACTACCTTGGTATGATTTTAGTTCTTTT
CAATTGTATGATCATGGATGAATTTTATTGTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan