ESTScan Details for Unigene SGN-U580180

Score 
1193
Direction 
Forward
Predicted Peptide Sequence 
MGLNGVDLTDDGDGGGGDVGGGEDKASVVSCSICLEAVTDNGDDPGRSFNVDINFILIALVLPLTSRGKCSVPTVGKXEKGQWLYASGCR
PLPDFNMEDWAHDEDLYDLSYTEMSFGVHWCPFSGLTRLPASFDEGELSSSAYHDLLGQHAIFADHTAVSSAAHPCPYIAYVGIHPSSSN
SSGSINDGPNFNNHWTSPSVPNEIPASYAFPGMDVHYHSWDHHSSFPMASSRVGTADQSSVPSVTQRVARTNADIPRPGSFVPPFLVGHG
SAARAGSSVASPMIPPYPGSVARARDRVQALQAYFQQPSNSPAVRTPVMSATRRSNNHRGLAQVGPAASSSDQAGGFYFYPSSSSGRNFQ
EAENPVSNRYHAWEREHLPAFPLSQVDRDPIWGPFHHTGVGSDSGSRAGSFRPDMGLKDAVPEPVMNFCAVLMRTVITLNEPNXMYVLRK
RSKMVGVLSIWQVQNCFVAMKSDPFLMAMSCVMGPWRSLVSVLWGINNIXNVNGKVQASDLPLYLQCLVTHISVILVNGLNIDEPVECSF
GQXEPVVQIGSTVEATTASFMGDKELKLLTVLSK
Predicted Coding Sequence 
ATGGGATTGAATGGTGTGGATCTTACGGATGACGGCGACGGAGGAGGAGGAGATGTTGGTGGAGGAGAAGATAAGGCATCGGTGGTTTCG
TGTTCGATTTGTCTTGAAGCTGTAACCGACAATGGGGATGATCCTGGTCGAAGCTTCAATGTGGACATCAATTTCATCTTGATTGCATTG
GTTCTGCCTTTAACATCAAGGGGCAAATGCAGTGTCCCAACTGTCGGAAAAXTTGAGAAGGGTCAATGGCTATATGCAAGTGGTTGCCGT
CCCCTACCAGATTTCAACATGGAAGATTGGGCCCATGATGAAGACCTATATGATCTGAGCTACACTGAAATGTCATTTGGAGTTCACTGG
TGTCCGTTTAGTGGATTGACTCGACTACCAGCATCTTTTGACGAAGGGGAGCTTTCATCTAGTGCATATCATGATCTTCTTGGTCAGCAT
GCTATATTTGCTGATCACACAGCTGTATCATCTGCTGCTCATCCATGCCCGTATATTGCCTATGTTGGAATTCACCCATCATCCTCAAAT
TCGAGTGGAAGTATCAATGATGGTCCTAATTTCAACAATCACTGGACTAGTCCATCTGTTCCCAACGAGATACCTGCTTCTTATGCTTTC
CCAGGAATGGATGTGCATTATCATAGTTGGGATCATCATTCTTCTTTCCCTATGGCAAGCAGTCGTGTTGGTACTGCTGATCAGTCCTCG
GTTCCCTCTGTTACTCAGAGAGTTGCCAGGACCAATGCTGATATCCCAAGACCAGGATCTTTTGTCCCTCCATTCCTTGTTGGTCACGGT
TCTGCTGCCAGAGCTGGAAGTTCAGTTGCTTCACCAATGATACCTCCTTATCCTGGAAGTGTAGCTCGGGCTCGTGACCGTGTTCAAGCT
CTTCAAGCCTATTTTCAGCAACCAAGTAATTCACCAGCTGTACGCACTCCTGTTATGTCTGCTACTCGACGATCCAACAATCACAGAGGG
TTGGCTCAAGTGGGGCCGGCTGCCTCATCATCTGATCAGGCTGGTGGCTTCTACTTCTATCCTTCAAGTTCTTCAGGAAGAAATTTCCAA
GAAGCAGAAAATCCAGTATCAAACAGATATCACGCTTGGGAACGAGAACACTTGCCCGCCTTCCCCTTGAGTCAGGTTGACAGAGATCCT
ATTTGGGGGCCATTTCATCACACAGGTGTTGGATCTGATAGTGGTAGCCGAGCTGGCAGCTTCCGACCAGACATGGGTCTGAAGGATGCC
GTCCCAGAACCGGTCATGAACTTCTGTGCTGTTTTGATGAGAACTGTGATTACTTTGAATGAACCCAATTTXATGTATGTTTTGAGAAAA
CGATCTAAAATGGTTGGAGTCTTGTCAATTTGGCAGGTTCAAAACTGTTTCGTGGCCATGAAAAGTGATCCCTTTCTGATGGCCATGAGT
TGTGTGATGGGACCGTGGCGCTCTCTTGTTTCTGTGCTGTGGGGTATAAATAACATCAXCAATGTTAATGGCAAAGTTCAAGCTAGTGAT
TTGCCTCTTTATCTGCAGTGCTTGGTTACCCATATTTCTGTCATATTAGTAAATGGTTTGAACATTGATGAACCTGTTGAATGTAGTTTT
GGTCAACAXGAACCTGTTGTTCAGATTGGTTCTACGGTTGAAGCAACCACTGCATCCTTTATGGGTGACAAAGAATTAAAGCTATTGACT
GTTTTAAGTAAA
Edits in Original Sequence 
GAAAAGAATATAGTTCCGTAAAACAGGCGGTGAGGAGAGAGAATATGTTTTTAGGAAAATAGAAAGAAAAAGAGGTTCACAGTTTTTGTA
CAGCCTCATCCATCTTCTCGTCTCTTCTCTTCTCTTCTCACCTATCACCAAATCGCTTCCTCAATATTCCGAGACCCTTTTGCTTAGCCT
TCTTAATCGGATTCTCCTCATCTTTTTTTTTCTTACATACCCCCCCTTTTCTTTTTTCATCAACAAAGATCAACGCAAGATTACCGTTTT
TCTTTTTTCTTCTTTTCTTCTTTTTGCTAGGAGTAAACCAAGTTGTTGTAGCTTGTGTTTGACAGTAAATT
(5')ATGGGATTGAATGGT
GTGGATCTTACGGATGACGGCGACGGAGGAGGAGGAGATGTTGGTGGAGGAGAAGATAAGGCATCGGTGGTTTCGTGTTCGATTTGTCTT
GAAGCTGTAACCGACAATGGGGATaGATCCTGGTCGAAGCTTCAATGTGGACATCAATTTCATCTTGATTGCATTGGTTCTGCCTTTAAC
ATCAAGGGGCAAATGCAGTGTCCCAACTGTCGGAAAAXTTGAGAAGGGTCAATGGCTATATGCAAGTGGTTGCCGTCCCCTACCAGATTT
CAACATGGAAGATTGGGCCCATGATGAAGACCTATATGATCTGAGCTACACTGAAATGTCATTTGGAGTTCACTGGTGTCCGTTTAGTGG
ATTGACTCGACTACCAGCATCTTTTGACGAAGGGGAGCTTTCATCTAGTGCATATCATGATCTTCTTGGTCAGCATGCTATATTTGCTGA
TCACACAGCTGTATCATCTGCTGCTCATCCATGCCCGTATATTGCCTATGTTGGAATTCACCCATCATCCTCAAATTCGAGTGGAAGTAT
CAATGATGGTCCTAATTTCAACAATCACTGGACTAGTCCATCTGTTCCCAACGAGATACCTGCTTCTTATGCTTTCCCAGGAATGGATGT
GCATTATCATAGTTGGGATCATCATTCTTCTTTCCCTATGGCAAGCAGTCGTGTTGGTACTGCTGATCAGTCCTCGGTTCCCTCTGTTAC
TCAGAGAGTTGCCAGGACCAATGCTGATATCCCAAGACCAGGATCTTTTGTCCCTCCATTCCTTGTTGGTCACGGTTCTGCTGCCAGAGC
TGGAAGTTCAGTTGCTTCACCAATGATACCTCCTTATCCTGGAAGTGTAGCTCGGGCTCGTGACCGTGTTCAAGCTCTTCAAGCCTATTT
TCAGCAACCAAGTAATTCACCAGCTGTACGCACTCCTGTTATGTCTGCTACTCGACGATCCAACAATCACAGAGGGTTGGCTCAAGTGGG
GCCGGCTGCCTCATCATCTGATCAGGCTGGTGGCTTCTACTTCTATCCTTCAAGTTCTTCAGGAAGAAATTTCCAAGAAGCAGAAAATCC
AGTATCAAACAGATATCACGCTTGGGAACGAGAACACTTGCCCGCCTTCCCCTTGAGTCAGGTTGACAGAGATCCTATTTGGGGGCCATT
TCATCACACAGGTGTTGGATCTGATAGTGGTAGCCGAGCTGGCAGCTTCCGACCgAGACATGGGTCTGAgAGGATGCCGTCCCAGAACCG
GTCATGAACTTCTGTGCTGTTTTGATGAGAACTGTGATTACTTTGAATGAACCCAATTTXATGTATGTTTTGAGAAAACGATCTAAAATG
GTTGGAGTCTTGTCAATTTGGCAGGTTCAAAACTGTTTCGTGGCCATGAAAAGTGATCCCTTTCTGATGGCCATGAGTTGTGTGATGGGA
CCGTGGCGCTCTCTTGTTTCTGTGCTGTGGGGTATAAATAACATCAXCAATGTTAATGGCAAAGTTCAAGCTAGTGATTTGCCTCTTTAT
CTGCAGTGCTTGGTTACCCATATTTCTGTCATATTAGTAAATGGTTTGAACATTGATGAACCTGTTGAATGTAGTTTTGGTCAACAXGAA
CCTGTTGTTCAGATTGGTTCTACGGTTGAAGCAACCACTGCATCCTTTATGGGTGACAAAGAATTAAAGCTATTaGACTGTTTTAAGTAA
A(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan