ESTScan Details for Unigene SGN-U580191

Score 
1858
Direction 
Forward
Predicted Peptide Sequence 
MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAEVNAVSXIDIALWKFETTKYYCTVI
DAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK
VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQLNEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGP
TGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
AEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPSGAKVTKAAQKKK*IV
QFNSGVTRDISIYYNKVCYENLLYFTLPAHVQSFMLLFGSCFLPCMSXYPFPELGARQTVAKDTVKSHLVYLLRCLGSSKTG*
Predicted Coding Sequence 
ATGGGTAAAGAGAAGGTTCACATCAACATTGTGGTTATTGGCCATGTTGACTCTGGCAAATCGACTACCACTGGTCACTTGATCTACAAG
CTAGGTGGTATCGATAAACGTGTCATCGAGAGGTTTGAGAAAGAAGCTGCTGAGATGAACAAGAGGTCATTCAAGTATGCCTGGGTTCTT
GACAAGCTCAAGGCTGAAGTGAACGCGGTATCAXCTATTGATATTGCCTTGTGGAAGTTTGAGACTACCAAGTACTATTGTACTGTCATT
GATGCTCCTGGTCATAGGGATTTCATCAAGAACATGATTACTGGTACCTCTCAAGCTGACTGTGCTGTCCTGATTATCGACTCCACGACT
GGTGGTTTTGAAGCTGGTATCTCTAAGGATGGACAGACTCGTGAACATGCGTTGCTTGCTTTCACACTTGGTGTTAGGCAAATGATTTGT
TGCTGCAACAAGATGGATGCTACCACACCTAAGTACTCCAAGGCTAGGTATGATGAAATTGTGAAGGAAGTGTCTTCTTACCTTAAGAAG
GTTGGTTACAACCCTGACAAGATCCCATTTGTGCCGATTTCTGGTTTCGAAGGAGATAATATGATTGAGAGATCAACTAACCTGGACTGG
TACAAGGGTCCAACCCTTCTTGAGGCTCTTGACCAGCTTAATGAGCCTAAGAGGCCCTCGGACAAACCCTTGCGTCTTCCACTTCAGGAT
GTCTATAAGATTGGGGGGATTGGGACTGTTCCTGTTGGTCGTGTTGAGACTGGTGTGATTAAGCCTGGTATGGTTGTGACTTTTGGTCCT
ACTGGTCTGACTACTGAAGTTAAGTCTGTTGAGATGCATCATGAAGCTCTTCAAGAGGCACTGCCTGGTGATAATGTTGGTTTTAACGTC
AAGAATGTTGCGGTTAAGGATCTTAAACGTGGATTTGTTGCTTCCAACTCCAAGGATGACCCAGCTAAGGGGGCTGCTAGCTTCACCGCT
CAGGTCATCATCATGAACCATCCAGGACAGATTGGAAATGGATATGCTCCAGTGCTGGACTGTCACACCTCCCATATTGCTGTCAAGTTT
GCTGAGATCTTGACTAAGATTGACAGGCGTTCTGGTAAGGAACTCGAGAAGGAGCCTAAGTTCTTGAAGAACGGTGATGCTGGTATGGTT
AAGATGATTCCCACCAAGCCCATGGTTGTTGAGACATTCTCCGAGTACCCACCATTGGGACGTTTTGCTGTGAGGGACATGCGTCAAACT
GTTGCTGTTGGTGTTATCAAGAATGTTGACAAGAAGGACCCATCTGGAGCCAAGGTCACCAAGGCTGCTCAGAAGAAAAAATGAATAGTG
CAGTTCAACTCTGGAGTTACCAGAGATATCAGTATCTACTATAATAAAGTGTGTTATGAAAACTTGCTATACTTTACTCTTCCTGCTCAT
GTTCAGTCTTTTATGTTGTTGTTTGGTTCTTGTTTTCTGCCCTGTATGTCAGXGTATCCTTTCCCAGAACTGGGTGCTCGACAGACGGTG
GCAAAAGACACAGTTAAGAGTCATTTGGTTTATCTTTTGAGGTGCCTAGGTTCATCCAAGACAGGCTAA
Edits in Original Sequence 
GCTACATAAATATTTAAGTATTGCTTTGAACTATAAATATCGGTCTTTTAAATATTATGTCAAGTCAAAATTGTGTCACGTGAAATGAGA
CAGAGTGAGTACTGGTTTTTATTTGTTTGCTTTCTGTTTCTATATATTTGATAGTAGCTTGGATTAATTTAACTCAAGATTTGTGACTAA
AGTTCATTAGTTTTGTTCATCTTAAATGTCTCATAATTCCTGGAGAAGGATGCTTGCCTTCTAGATTGTTCAGTCTGTGTATTGTTTGAT
CATTGTTGGATGATCTGTTTCGTTGATTGGCTACCTAAACTCGATTTTGATGTATTCGATTTTTCAGAATTTCTCTATGTTTTGTGTGAA
TATCAGATTGTTGTAGACATAGAACACAACTTTTAGATGTACTTAACATATGTGCTGTGCCTTCTCTAGACTTCTAGTTGATCAAC
(5')
ATGGGTAAAGAGAAGGTTCACATCAACATTGTGGTTATTGGCCATGTTGACTCTGGCAAATCGACTACCACTGGTCACTTGATCTACAAG
CTAGGTGGTATCGATAAACGTGTCATCGAGAGGTTTGAGAAAGAAGCTGCTGAGATGAACAAGAGGTCATTCAAGTATGCCTGGGTTCTT
GACAAGCTCAAGGCTGAAcGTGAACGCGGTATCAXCTATTGATATTGCCTTGTGGAAGTTTGAGACTACCAAGTACTATTGTACTGTCAT
TGATGCTCCTGGTCATAGGGATTTCATCAAGAACATGATTACTGGTACCTCTCAAGCTGACTGTGCTGTCCTGATTATCGACTCCACGAC
TGGTGGTTTTGAAGCTGGTATCTCTAAGGATGGACAGACTCGTGAACATGCGTTGCTTGCTTTCACACTTGGTGTTAGGCAAATGATTTG
TTGCTGCAACAAGATGGATGCTACCACACCTAAGTACTCCAAGGCTAGGTATGATGAAATTGTGAAGGAAGTGTCTTCTTACCTTAAGAA
GGTTGGTTACAACCCTGACAAGATCCCATTTGTGCCGATTTCTGGTTTCGAAGGAGATAATATGATTGAGAGATCAACTAACCTGGACTG
GTACAAGGGTCCAACCCTTCTTGAGGCTCTTGACCAGCTTAATGAGCCTAAGAGGCCCTCGGACAAACCCTTGCGTCTTCCACTTCAGGA
TGTCTATAAGATTGGGGGGATTGGGACTGTTCCTGTTGGTCGTGTTGAGACTGGTGTGATTAAGCCTGGTATGGTTGTGACTTTTGGTCC
TACTGGTCTGACTACTGAAGTTAAGTCTGTTGAGATGCATCATGAAGCTCTTCAAGAGGCACTGCCTGGTGATAATGTTGGTTTTAACGT
CAAGAATGTTGCGGTTAAGGATCTTAAACGTGGATTTGTTGCTTCCAACTCCAAGGATGACCCAGCTAAGGGGGCTGCTAGCTTCACCGC
TCAGGTCATCATCATGAACCATCCAGGACAGATTGGAAATGGATATGCTCCAGTGCTGGACTGTCACACCTCCCATATTGCTGTCAAGTT
TGCTGAGATCTTGACTAAGATTGACAGGCGTTCTGGTAAGGAACTCGAGAAGGAGCCTAAGTTCTTGAAGAACGGTGATGCTGGTATGGT
TAAGATGATTCCCACCAAGCCCATGGTTGTTGAGACATTCTCCGAGTACCCACCATTGGGACGTTTTGCTGTGAGGGACATGCGTCAAAC
TGTTGCTGTTGGTGTTATCAAGAATGTTGACAAGAAGGACCCATCTGGAGCCAAGGTCACCAAGGCTGCTCAGAAGAAAAAATGAATAGT
GCAGTTCAACTCTGGAGTTACCAGAGATATCAGTATCTACTATAATAAAGTGTGTTATGAAAACTTGCTATACTTTACTCTTCCTGCTCA
TGTTCAGTCTTTTATGTTGTTGTTTGGTTCTTGTTTTCTGCCCTGTATGTCAGXGTATCCTTTCCCAGAACTGGGTGCTCGACAGACGGT
GGCAAAAGACACAGTTAAGAGTCATTTGGTTTATCTTTTGAGGTGCCTAGGTTCATCCAAGACAGGCTAA(3')GAAGCTTTGTTATTTA
TGTTTTCTTATAACACGTAAATCGTACTTTTTCTGTTTTTGTGCTGAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan