ESTScan Details for Unigene SGN-U580210

Score 
684
Direction 
Forward
Predicted Peptide Sequence 
MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGATVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISK
ASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFIDHPGAVPITTAQGEELRKTIGAPSYIECSSKTQENVKGVFDAAIKVXAPA
TQGKEKEREVPKGLLNFVINSWSGVIPGHSFHTL*
Predicted Coding Sequence 
ATGAGCGCATCCAGGTTCATCAAGTGTGTCACCGTTGGTGATGGTGCTGTTGGAAAGACATGCCTCTTGATTTCCTACACCAGCAATACC
TTCCCCACGGATTATGTGCCAACTGTGTTTGACAATTTCAGTGCAAATGTGGTTGTCAATGGGGCTACTGTCAACCTAGGGTTGTGGGAT
ACTGCTGGACAGGAGGATTACAATAGGTTAAGACCTCTGAGTTATCGTGGAGCTGATGTTTTCATTTTGGCATTCTCTCTCATCAGTAAA
GCCAGTTATGAAAATGTTTCCAAGAAGTGGATTCCTGAGTTGAAGCATTACGCCCCTGGTGTCCCTATTGTGCTTGTTGGAACAAAACTT
GATCTTCGAGATGATAAGCAATTCTTCATAGACCATCCAGGTGCCGTGCCAATTACTACTGCTCAGGGTGAAGAGCTGAGGAAAACAATT
GGTGCACCTTCCTACATTGAATGTAGTTCAAAAACACAGGAGAATGTAAAAGGAGTATTTGATGCTGCCATTAAAGTTGXTGCTCCAGCC
ACCCAAGGCAAAGAAAAAGAAAGGGAAGTCCCAAAGGGCCTGCTCAATTTTGTGATCAACAGTTGGTCCGGGGTTATTCCTGGTCACAGT
TTTCACACGTTGTAA
Edits in Original Sequence 
GGGCGGAGAGAGATGTGAAGAACGGTTCAACGGCATAATTTTGCGGCTAAAAAATGCGAGCCATAATATAATGGCATTACAAACCCTAGT
CATGTCATCATCATCTATTTCTCTCTTGCATCTTTCTTCCCTTTTCTCTTTTACCCATTTCTTCCTATTTTAGGGTTAGGGTTCCTCTTT
CTCATTCTTCTTGTTTGTTTATCTTCATTATTGTATTGTATGTACAAATGTGTGATTGAAATCAAACTCCCATCAATCTCTATTTTCTCT
GTTTATACAACAATCAGGTCTTCTGCAGAAGATCTGAGAGAGAGGGATACCTACCAAA
(5')ATGAGCGCATCCAGGTTCATCAAGTGTG
TCACCGTTGGTGATGGTGCTGTTGGAAAGACATGCCTCTTGATTTCCTACACCAGCAATACCTTCCCCACGGATTATGTGCCAACTGTGT
TTGACAATTTCAGTGCAAATGTGGTTGTCAATGGGGCTACTGTCAACCTAGGGTTGTGGGATACTGCTGGACAGGAGGATTACAATAGGT
TAAGACCTCTGAGTTATCGTGGAGCTGATGTTTTCATTTTGGCATTCTCTCTCATCAGTAAAGCCAGTTATGAAAATGTTTCCAAGAAGT
GGATTCCTGAGTTGAAGCATTACGCCCCTGGTGTCCCTATTGTGCTTGTTGGAACAAAACTTGATCTTCGAGATGATAAGCAATTCTTCA
TAGACCATCCAGGTGCCGTGCCAATTACTACTGCTCAGGGTGAAGAGCTGAGGAAAACAATTGGTGCACCTTCCTACATTGAATGTAGTT
CAAAAACACAGGAGAATGTAAAAGGAGTATTTGATGCTGCCATTAAAGTTGXTGCTCCAGCCACCCAAGGCAAAGAAAAAGAAAGGGAAG
TCCCAAAGGGCCTGCTCAATTTTGTGATCAACAGTTGGTCCGGGGTTATTCCTGGTCACAGTTTTCACACGTTGTAA(3')TCTGTCCCC
TCATATCTGTTTCTGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan