Notice: After server upgrades, BLAST should be back now. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U580248

Score 
597
Direction 
Forward
Predicted Peptide Sequence 
GDISALISGFSLNRSLILKALFRDHHQGSVMGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQ
RHWYIQSTCATSGEGLYEGLDWLSNNIANKA*
Predicted Coding Sequence 
GGGGATATTTCAGCGTTAATCTCAGGTTTCTCTCTCAATAGATCCCTCATTCTAAAAGCTCTTTTCAGGGATCATCATCAAGGAAGCGTG
ATGGGGCTCACATTCACCAAGCTCTTCAGTCGGCTTTTCGCCAAGAAGGAAATGCGCATTCTAATGGTTGGTCTTGATGCAGCTGGTAAG
ACCACCATATTGTACAAGTTGAAGCTGGGAGAGATCGTGACTACTATTCCTACCATTGGTTTCAATGTGGAGACTGTTGAGTACAAGAAC
ATCAGCTTCACTGTTTGGGATGTCGGAGGTCAGGACAAGATCCGTCCATTGTGGAGGCACTACTTCCAGAACACTCAGGGTCTCATTTTT
GTGGTTGATAGCAATGATAGAGACCGTGTTGTAGAAGCAAGAGATGAATTGCATAGGATGTTGAACGAGGATGAACTTCGGGATGCTGTG
CTTCTAGTATTTGCTAACAAACAAGATCTTCCTAACGCAATGAATGCTGCTGAAATAACTGATAAGCTTGGACTGCACTCCCTCAGGCAG
CGTCACTGGTACATCCAGAGCACTTGTGCAACTTCTGGCGAGGGGCTTTATGAGGGACTTGATTGGCTTTCTAACAACATTGCTAACAAG
GCTTAA
Edits in Original Sequence 
(5')GGGGATATTTCAGCGTTAATCTCAGGTTTCTCTCTCAATAGATCCCTCATTCTAAAAGCTCTTTTCAGGGATCATCATCAAGGAAG
CGTGATGGGGCTCACATTCACCAAGCTCTTCAGTCGGCTTTTCGCCAAGAAGGAAATGCGCATTCTAATGGTTGGTCTTGATGCAGCTGG
TAAGACCACCATATTGTACAAGTTGAAGCTGGGAGAGATCGTGACTACTATTCCTACCATTGGTTTCAATGTGGAGACTGTTGAGTACAA
GAACATCAGCTTCACTGTTTGGGATGTCGGAGGTCAGGACAAGATCCGTCCATTGTGGAGGCACTACTTCCAGAACACTCAGGGTCTCAT
TTTTGTGGTTGATAGCAATGATAGAGACCGTGTTGTAGAAGCAAGAGATGAATTGCATAGGATGTTGAACGAGGATGAACTTCGGGATGC
TGTGCTTCTAGTATTTGCTAACAAACAAGATCTTCCTAACGCAATGAATGCTGCTGAAATAACTGATAAGCTTGGACTGCACTCCCTCAG
GCAGCGTCACTGGTACATCCAGAGCACTTGTGCAACTTCTGGCGAGGGGCTTTATGAGGGACTTGATTGGCTTTCTAACAACATTGCTAA
CAAGGCTTAA(3')AGTGATGCAGATTTGTTATTGTGGGTTGATCCTGGATGCAGGCGGAGTTTTATCTAGTTTTTTTTACTTCTCATGT
CAGTGTGGTTATGAATATCATGTTGAAAGCATTTTGTGTTTCCTTAGGGCTTTTTGTAATGGCTGTGTAATACAATGGTCGAATATATGT
AATTGCTGTTTGATTAGGTAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan