ESTScan Details for Unigene SGN-U580292

Score 
1073
Direction 
Forward
Predicted Peptide Sequence 
QINENLSHSLVRILCLTSITRFKKIGRLXIEAAIMAHLLSTTCSLDVSSSKKLHFKSINQCSTPNPTCFNMGISFSPLKLSLQSKRSAKY
VIRASAVSMSQEARTQNDSGSQQTTDGASTRKKVMVIGGDGYCGWATALHLSNKGYEVAIVDNLIRRLFDDQLGLDSLTPISSIHNRIRR
WKSLTGKDIQLFVGDICEFEFLAEAFKSFEPDAVVHFGEQRSAPYSMIDRSRAIYTQHNNVIGTLNVLFAIKEFREECHLVKLGTMGEYG
TPNIDIEEGYITITHNGRTDTLPYPKQASSFYHLSKVHDSHNIALTCKAWGIRATDLNQGVVYGVRTDETAIHEDLVNRLDYDGVFGTAL
NRFCVQAAVGHPLTVYGKGGQTRGYLDIRDTVQCVEIAIANPAKPGEFRVFNQFTEQFSVNELAALVTKAGQKLGLEVKAISVPNPRVEA
EEHYYNAKHTKLIELGLQPHLLSDSLLDSLLNFAVQYKDRVDTKQIMPSVSWKKIGAKPKTVAAKSLRQAIET*
Predicted Coding Sequence 
CAGATAAATGAAAACCTTTCTCACTCTCTTGTAAGGATTTTATGTCTAACAAGCATCACCAGGTTTAAGAAAATTGGTAGGCTCATXATC
GAGGCGGCTATCATGGCACATTTACTTTCTACTACATGTTCTTTAGATGTCTCTTCCAGCAAAAAGCTGCATTTCAAGTCAATTAACCAA
TGCTCTACTCCTAATCCAACATGTTTTAATATGGGAATTTCTTTCTCACCCTTGAAGCTAAGTTTGCAAAGCAAAAGGTCTGCAAAATAT
GTGATCAGAGCTTCAGCTGTTTCCATGAGCCAAGAAGCCAGAACACAGAATGACTCTGGTTCTCAACAGACCACTGATGGAGCATCCACT
AGGAAGAAGGTCATGGTCATTGGTGGTGATGGCTATTGTGGCTGGGCTACTGCTCTCCACCTATCCAACAAGGGATATGAAGTTGCCATT
GTTGACAACCTTATCCGTCGATTATTTGACGACCAGCTTGGTCTAGATTCTCTAACACCCATCTCATCTATTCATAACCGCATAAGGCGT
TGGAAATCTCTCACAGGAAAAGATATTCAACTGTTTGTTGGTGATATATGTGAGTTTGAGTTCTTGGCAGAAGCCTTCAAATCCTTTGAA
CCTGATGCTGTAGTCCATTTTGGAGAGCAGAGGTCTGCCCCTTATTCTATGATTGATAGGTCAAGAGCTATTTATACCCAACATAATAAT
GTGATAGGGACACTTAATGTACTATTTGCCATAAAGGAGTTTAGGGAAGAGTGTCATTTGGTCAAACTCGGGACCATGGGGGAATATGGA
ACCCCTAATATAGATATTGAAGAAGGTTATATAACTATTACTCATAACGGAAGAACAGATACTCTTCCTTATCCCAAACAAGCAAGCTCC
TTCTATCATTTGAGTAAAGTCCATGATTCCCACAACATAGCCCTCACTTGCAAGGCGTGGGGAATCAGAGCTACCGACCTGAATCAGGGA
GTTGTATATGGGGTGAGGACTGATGAAACTGCAATACATGAGGATCTGGTTAACAGACTTGATTATGATGGTGTATTTGGAACTGCACTA
AATCGTTTCTGTGTTCAGGCTGCTGTTGGACATCCACTAACGGTGTATGGTAAAGGAGGGCAGACCAGGGGATATTTGGATATCAGAGAT
ACAGTTCAATGTGTTGAAATTGCAATTGCCAATCCAGCAAAACCAGGAGAGTTCCGGGTTTTCAACCAATTCACAGAGCAGTTTTCAGTA
AATGAGCTTGCAGCCCTTGTCACCAAGGCAGGGCAAAAACTTGGCCTTGAGGTGAAGGCCATATCAGTGCCCAATCCAAGAGTAGAAGCA
GAGGAACACTACTACAATGCCAAACATACTAAACTTATTGAGCTGGGACTACAACCTCACCTTCTTTCTGATTCTCTTCTCGACTCTCTA
TTGAACTTTGCTGTTCAATATAAGGATCGTGTCGACACAAAGCAGATAATGCCTAGTGTTTCCTGGAAAAAAATTGGCGCGAAGCCAAAG
ACTGTTGCAGCAAAATCACTTAGACAAGCTATAGAGACTTGA
Edits in Original Sequence 
(5')CAGATAAATGAAAACCTTTCTCACTCTCTTGTAAGGATTTTATGTCTAACAAGCATCACCAGGTTTAAGAAAATTGGTAGGCTCAT
XATCGAGGCGGCTATCATGGCACATTTACTTTCTACTACATGTTCTTTAGATGTCTCTTCCAGCAAAAAGCTGCATTTCAAGTCAATTAA
CCAATGCTCTACTCCTAATCCAACATGTTTTAATATGGGAATTTCTTTCTCACCCTTGAAGCTAAGTTTGCAAAGCAAAAGGTCTGCAAA
ATATGTGATCAGAGCTTCAGCTGTTTCCATGAGCCAAGAAGCCAGAACACAGAATGACTCTGGTTCTCAACAGACCACTGATGGAGCATC
CACTAGGAAGAAGGTCATGGTCATTGGTGGTGATGGCTATTGTGGCTGGGCTACTGCTCTCCACCTATCCAACAAGGGATATGAAGTTGC
CATTGTTGACAACCTTATCCGTCGATTATTTGACGACCAGCTTGGTCTAGATTCTCTAACACCCATCTCATCTATTCATAACCGCATAAG
GCGTTGGAAATCTCTCACAGGAAAAGATATTCAACTGTTTGTTGGTGATATATGTGAGTTTGAGTTCTTGGCAGAAGCCTTCAAATCCTT
TGAACCTGATGCTGTAGTCCATTTTGGAGAGCAGAGGTCTGCCCCTTATTCTATGATTGATAGGTCAAGAGCTATTTATACCCAACATAA
TAATGTGATAGGGACACTTAATGTACTATTTGCCATAAAGGAGTTTAGGGAAGAGTGTCATTTGGTCAAACTCGGGACCATGGGGGAATA
TGGAACCCCTAATATAGATATTGAAGAAGGTTATATAACTATTACTCATAACGGAAGAACAGATACTCTTCCTTATCCCAAACAAGCAAG
CTCCTTCTATCATTTGAGTAAAGTCCATGATTCCCACAACATAGCCCTCACTTGCAAGGCGTGGGGAATCAGAGCTACCGACCTGAATCA
GGGAGTTGTATATGGGGTGAGGACTGATGAAACTGCAATACATGAGGATCTGGTTAACAGACTTGATTATGATGGTGTATTTGGAACTGC
ACTAAATCGTTTCTGTGTTCAGGCTGCTGTTGGACATCCACTAACGGTGTATGGTAAAGGAGGGCAGACCAGGGGATATTTGGATATCAG
AGATACAGTTCAATGTGTTGAAATTGCAATTGCCAATCCAGCAAAACCAGGAGAGTTCCGGGTTTTCAACCAATTCACAGAGCAGTTTTC
AGTAAATGAGCTTGCAGCCCTTGTCACCAAGGCAGGGCAAAAACTTGGCCTTGAGGTGAAGGCCATATCAGTGCCCAATCCAAGAGTAGA
AGCAGAGGAACACTACTACAATGCCAAACATACTAAACTTATTGAGCTGGGACTACAACCTCACCTTCTTTCTGATTCTCTTCTCGACTC
TCTATTGAACTTTGCTGTTCAATATAAGGATCGTGTCGACACAAAGCAGATAATGCCTAGTGTTTCCTGGAAAAAAATTGGCGCGAAGCC
AAAGACTGTTGCAGCAtAAATCACTTAGACAAGCTATAGAGACTTGA(3')GACTGGGAGTTCTTGTATGTCATTTTTATATAGGAGCTA
TAGTATTTTACAATGCCTTGCACAATTTTATGTTGTAACTTTGGGAAGTATTTGTTGTATTCCGAAGCTTGTGAAGGTTGTGGATGTAGT
TTTTGTTTGAGAAAATACTCGAGGTAGTCGTGACCTGTCTCAAGCCTGAAACTTGTGTGATTTACTTGTCAATTTAGTTTTGGCTACACA
GAAGTGTTCCCGGATATCTTCCTCATTGGACAGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan