ESTScan Details for Unigene SGN-U580360

Score 
2106
Direction 
Forward
Predicted Peptide Sequence 
MTISSLLLPPPPPFINYNNNNNNIYGKSISIHQPHRFSFRVINDSNRTELATEDADKLVDGMDFGELCDEFECISSPSVEATARQLVRDI
LELREGNRALGTFAVSVKYKDPVRSFTGRDKYKRPLWITDALQNPKPSVQEMVMLSTSVLNIKWTIKGKAKSLIGSIGGDLMIKVNSRFT
LNQISGQVVEHEEEWDLSGSSIIAQAYFWASRRLFATVEAGKDVVDIVNDLSSKSAKENKNMDVYPDPYGDPAKFFQRDDSFQRDFYQIA
LLLAVIYFVVQFLGQLYETPNFNTCIIVIIXISLETVIPLKELAFDDRKXIKNLNNLVKFRSDYTLYKNHATSSSILIQKNGSSRECISG
FIEAELPETSKERLLLLRKGYSDLSVGGGGGFTGNENFLERIRYRVSEYCNNVKQAASKAVKMGRSDPRKIIFSAKVGFALALVSILIFF
KEPIPYIGSHSIWAILTVVVVFEFSIGATLNKGFNRALGTFSAGGLALGIAELSLMAGGFREILIVISVFIAGFCATYMKLYPPLKEYEY
GFRVFLLTYCIVLVSGTSDFVKTAVSRLLLIGVGAAVCLVINICIFPIWAGEDLHKLVVKNFKGVATSLKAASELRRTFMKEIRRVGTEG
AKVIRLLGEKVEKMEKLSPGDPLKDVHEAAEDLQLLIDQKSYLLVNAENWESSKRPKKFEDPERLQELKDNEPKPMVINSLSEATLHLRS
AHTLKHMDTLNPNVSVNFSTSQWGSSADVFAQQTMWPSRLSLIGDVILNEREVRTFESASTLSLATFTSLLIEFVARLQNLLHAFQELSE
KAKFKEPVDTKEATLSEAGYVTDPAFIIEGTFLSAIDNHKVVINQKLSCQVLALXDDYVYYN*
Predicted Coding Sequence 
ATGACCATTTCTTCTCTTCTTCTTCCTCCTCCTCCTCCTTTCATCAATTACAATAATAATAATAATAATATTTATGGAAAGTCTATTTCC
ATTCATCAACCTCATCGATTTTCGTTCCGAGTTATCAATGATTCGAATAGAACAGAGTTAGCTACTGAAGATGCTGATAAACTTGTAGAT
GGAATGGATTTTGGGGAATTGTGTGATGAGTTTGAATGCATTAGTAGCCCTTCTGTGGAAGCTACTGCTAGGCAGCTAGTTCGAGATATT
CTCGAACTACGTGAAGGCAATCGTGCCCTCGGTACCTTTGCTGTCTCTGTCAAGTATAAGGATCCAGTGAGAAGTTTTACAGGACGAGAC
AAGTACAAGAGACCATTATGGATAACTGATGCTCTGCAGAATCCTAAACCGAGTGTGCAAGAAATGGTGATGTTATCAACAAGTGTGTTG
AATATTAAGTGGACAATAAAAGGAAAAGCAAAGTCATTGATTGGTAGCATAGGAGGGGATTTGATGATCAAAGTAAATTCAAGATTCACT
TTGAATCAAATAAGTGGACAAGTAGTTGAGCATGAAGAGGAATGGGATTTATCAGGATCATCCATCATTGCTCAAGCTTATTTCTGGGCA
TCGCGACGACTATTTGCTACTGTTGAAGCTGGAAAAGATGTGGTTGATATTGTTAATGACTTGAGTTCTAAATCTGCTAAAGAGAATAAA
AACATGGATGTTTATCCTGACCCTTATGGTGATCCAGCAAAGTTCTTTCAAAGGGATGACAGTTTCCAAAGAGATTTTTACCAAATTGCA
TTGCTGCTGGCTGTTATATATTTTGTCGTACAGTTCTTGGGACAACTTTATGAGACTCCTAATTTTAACACTTGTATAATTGTAATTATT
AAXATCTCTTTGGAAACTGTCATCCCTTTGAAAGAACTTGCATTTGACGACAGAAAAXCAATAAAGAATCTCAATAATTTAGTCAAATTC
AGATCAGATTATACACTCTATAAGAATCATGCAACTTCTTCATCAATTTTGATCCAAAAAAATGGCAGCAGCAGGGAATGCATATCTGGG
TTCATTGAAGCAGAGCTTCCTGAAACAAGCAAAGAAAGATTGTTACTACTCAGAAAAGGCTACTCAGACTTGAGTGTAGGTGGTGGTGGT
GGTTTTACTGGAAACGAGAACTTTCTAGAACGTATTCGTTATCGAGTTTCTGAGTACTGTAACAATGTCAAACAAGCTGCAAGTAAAGCA
GTTAAAATGGGTCGCAGTGATCCGAGAAAGATTATCTTTTCTGCTAAAGTGGGTTTTGCTCTTGCCCTTGTTTCCATTCTCATTTTCTTC
AAAGAACCCATACCCTATATTGGTAGCCACTCCATTTGGGCGATTCTTACCGTTGTCGTCGTTTTTGAATTCAGCATAGGGGCGACGCTT
AACAAAGGATTTAACAGGGCTTTGGGGACATTTTCTGCTGGAGGATTAGCTTTGGGCATTGCTGAACTGTCTCTTATGGCTGGAGGATTT
CGAGAGATTTTGATTGTGATCAGTGTATTTATTGCAGGATTTTGTGCGACTTATATGAAATTGTATCCTCCACTGAAGGAGTATGAATAT
GGATTCCGGGTCTTCTTATTGACATATTGTATAGTGCTAGTATCCGGGACTTCGGATTTTGTAAAGACAGCTGTTTCTCGATTGTTACTT
ATTGGGGTTGGAGCTGCTGTTTGTTTGGTTATTAATATATGCATCTTCCCCATTTGGGCTGGTGAAGATTTGCACAAATTGGTGGTGAAA
AACTTTAAGGGTGTCGCTACTTCTTTGAAGGCAGCATCTGAATTAAGGCGGACTTTTATGAAGGAGATTCGGAGAGTTGGGACTGAAGGA
GCTAAAGTGATACGACTGCTTGGGGAGAAAGTTGAAAAGATGGAGAAACTAAGCCCCGGAGATCCTCTCAAAGATGTTCATGAAGCTGCT
GAGGATCTCCAATTGTTGATTGACCAAAAATCTTATCTTTTGGTTAATGCAGAGAATTGGGAAAGTTCAAAAAGACCTAAGAAGTTTGAA
GATCCTGAACGCCTACAAGAGCTTAAGGACAATGAACCTAAACCAATGGTAATTAACTCCCTTAGTGAAGCAACTCTCCATCTAAGGTCT
GCTCACACATTGAAACACATGGATACTCTTAATCCAAATGTAAGTGTCAACTTTTCTACTTCACAATGGGGTTCCTCAGCAGATGTATTC
GCGCAGCAGACAATGTGGCCTTCACGGCTTTCACTTATTGGAGATGTGATTTTAAATGAACGTGAAGTACGGACTTTTGAAAGTGCTAGT
ACATTATCACTGGCAACATTTACGTCCCTGTTGATTGAGTTTGTTGCAAGACTTCAGAATCTTCTACATGCATTTCAAGAGCTCAGTGAA
AAGGCAAAATTTAAGGAACCTGTAGATACAAAAGAGGCAACTCTCTCTGAGGCAGGTTATGTAACCGATCCTGCTTTTATTATCGAGGGA
ACCTTTCTTTCTGCTATTGACAATCACAAAGTTGTTATCAATCAAAAACTTTCATGTCAGGTTTTGGCTCTTGAXGATGATTATGTATAC
TATAACTAA
Edits in Original Sequence 
GAATTAACCTAATTAGTAATCATGAAGAAACAAACAAT(5')ATGACCATTTCTTCTCTTCTTCTTCCTCCTCCTCCTCCTTTCATCAAT
TACAATAATAATAATAATAATATTTATGGAAAGTCTATTTCCATTCATCAACCTCATCGATTTTCGTTCCGAGTTATCAATGATTCGAAT
AGAACAGAGTTAGCTACTGAAGATGCTGATAAACTTGTAGATGGAATGGATTTTGGGGAATTGTGTGATGAGTTTGAATGCATTAGTAGC
CCTTCTGTGGAAGCTACTGCTAGGCAGCTAGTTCGAGATATTCTCGAACTACGTGAAGGCAATCGTGCCCTCGGTACCTTTGCTGTCTCT
GTCAAGTATAAGGATCCAGTGAGAAGTTTTACAGGACGAGACAAGTACAAGAGACCATTATGGATAACTGATGCTCTGCAGAATCCTAAA
CCGAGTGTGCAAGAAATGGTGATGTTATCAACAAGTGTGTTGAATATTAAGTGGACAATAAAAGGAAAAGCAAAGTCATTGATTGGTAGC
ATAGGAGGGGATTTGATGATCAAAGTAAATTCAAGATTCACTTTGAATCAAATAAGTGGACAAGTAGTTGAGCATGAAGAGGAATGGGAT
TTATCAGGATCATCCATCATTGCTCAAGCTTATTTCTGGGCATCGCGACGACTATTTGCTACTGTTGAAGCTGGAAAAGATGTGGTTGAT
ATTGTTAATGACTTGAGTTCTAAATCTGCTAAAGAGAATAAAAACATGGATGTTTATCCTGACCCTTATGGTGATCCAGCAAAGTTCTTT
CAAAGGGATGACAGTTTCCAAAGAGATTTTTACCAAATTGCATTGCTGCTGGCTGTTATATATTTTGTCGTACAGTTCTTGaGGACAACT
TTATGAGACTCCTAATTTTAACACTTGTATAATTGTAATTATTAAXATCTCTTTGGAAACTGTCATCCCTTTGAAAGAACtTTGCATTTG
ACGACAGAAAAXCAATAAAGAATCTCAATAATTTAGTCAAATTCAGATCAGATTATACACTCTATAAGAATCATGCAACTTCTTCATCAA
TTTTGATCCAAAAAAATGGCAGCAGCAGGGAATGCATATCTGGGTTCATTGAAGCAGAGCTTCCaTGAAACAAGCAAAGAAAGATTGTTA
CTACTCAGAAAAGGCTACTCAGACTTGAGTGTAGGTGGTGGTGGTGGTTTTACTGGAAACGAGAACTTTCTAGAACGTATTCGTTATCGA
GTTTCTGAGTACTGTAACAATGTCAAACAAGCTGCAAGTAAAGCAGTTAAAATGGGTCGCAGTGATCCGAGAAAGATTATCTTTTCTGCT
AAAGTGGGTTTTGCTCTTGCCCTTGTTTCCATTCTCATTTTCTTCAAAGAACCCATACCCTATATTGGTAGCCACTCCATTTGGGCGATT
CTTACCGTTGTCGTCGTTTTTGAATTCAGCATAGGGGCGACGCTTAACAAAGGATTTAACAGGGCTTTGGGGACATTTTCTGCTGGAGGA
TTAGCTTTGGGCATTGCTGAACTGTCTCTTATGGCTGGAGGATTTCGAGAGATTTTGATTGTGATCAGTGTATTTATTGCAGGATTTTGT
GCGACTTATATGAAATTGTATCCTCCACTGAAGGAGTATGAATATGGATTCCGGGTCTTCTTATTGACATATTGTATAGTGCTAGTATCC
GGGACTTCGGATTTTGTAAAGACAGCTGTTTCTCGATTGTTACTTATTGGGGTTGGAGCTGCTGTTTGTTTGGTTATTAATATATGCATC
TTCCCCATTTGGGCTGGTGAAGATTTGCACAAATTGGTGGTGAAAAACTTTAAGGGTGTCGCTACTTCTTTgGAAGGCAGCATCTGAATT
AAGGCGGACTTTTATGAAGGAGATTCGGAGAGTTGGGACTGAAGGAGCTAAAGTGATACGACTGCTTGGGGAGAAAGTTGAAAAGATGGA
GAAACTAAGCCCCGGAGATCCTCTCAAAGATGTTCATGAAGCTGCTGAGGATCTCCAATTGTTGATTGACCAAAAATCTTATCTTTTGGT
TAATGCAGAGAATTGGGAAAGTTCAAAAAGACCTAAGAAGTTTGAAGATCCTGAACGCCTACAAGAGCTTAAGGACAATGAACCTAAACC
AATGGTAATTAACTCCCTTAGTGAAGCAACTCTCCATCTAAGGTCTGCTCACACATTGAAACACATGGATACTCTTAATCCAAATGTAAG
TGTCAACTTTTCTACTTCACAATGGGGTTCCTCAGCAGATGTATTCGCGCAGCAGACAATGTGGCCTTCACGGCTTTCACTTATTGGAGA
TGTGATTTTAAATGAACGTGAAGTACGGACTTTTGAAAGTGCTAGTACATTATCACTGGCAACATTTACGTCCCTGTTGATTGAGTTTGT
TGCAAGACTTCAGAATCTTCTACATGCATTTCAAGAGCTCAGTGAAAAGGCAAAATTTAAGGAACCTGTAGATACAAAAGAGGCAACTaC
TCTCTGAGGCAGGTTATGTAACCGATCCTGCTTTTATTATCGAGGGAACCTTTCTTTCTGCTATTGACAATCACAAAGTTGTTATCAATC
AAAAACTTTCATGTCAGGTTTTGGCTCTTGAXGATGATTATGTATACTATAACTAA(3')GAACTGTAGAAATGTCAAGAAAAGGTTTTT
GTTCTGCAGCATGTCTTCAGAGCTGTGAATCCAATAGAAAAAAAATCTTCTTGACCCANAAAAGTGTATTAGTGCATGAAGAAGGAGTAA
ATTATAATATTTGTACTTGTTTCTGATGAATCTGTAAATTATTCAAGATCTTTAAAGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan