Notice: The contact form functionality has been restored. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U580380

Score 
956
Direction 
Forward
Predicted Peptide Sequence 
MTGTGDENQPKFKKSESQIPSVSSSSSDPQAPEMDPQKWGTHIMGPPAVPTCHPDNQKAASWRAEDQREEFQPQPYVVYSPIDKPSNNPL
DSVVNVFNSWSNRAENIARNIWYNLKAGPSVTEAAWGKLNLTAKALTEGGFEPLYKQIFGADPNEQLKKTFACYLSTATGPVAGTLYLST
TKVAFCSDRPLSYKAPSGQEAWSYYKVAVPLGNIGTINPIVMKESPPERYIQIVTIDGHDFWFMGFVNFDKAKHHLLETLSIFRAQPPHL
NLQQPAATXLEALPVLCFSVFFFLFVPALDMYLYFFYCNILVCLYIFGSDYVRFDVNKSSLRFNLFXLVLIDIEDFXDLKVKKKFGCTDA
TQVLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPEGY*
Predicted Coding Sequence 
ATGACAGGCACAGGAGACGAAAATCAACCCAAATTTAAAAAATCAGAGTCTCAAATACCTTCTGTTTCTTCATCATCTTCAGATCCACAA
GCACCAGAAATGGATCCCCAAAAATGGGGTACCCATATTATGGGTCCGCCTGCAGTTCCAACTTGTCATCCAGACAATCAGAAAGCTGCT
TCATGGAGAGCTGAGGATCAAAGAGAAGAGTTTCAGCCACAGCCTTATGTTGTTTATTCCCCAATTGATAAGCCTAGCAATAACCCACTT
GATTCCGTTGTTAATGTGTTCAATTCATGGAGTAACAGAGCTGAGAACATAGCTCGCAACATTTGGTATAATCTGAAAGCTGGACCGTCA
GTTACAGAAGCGGCATGGGGAAAACTTAATTTGACAGCTAAGGCGTTGACAGAGGGTGGATTTGAGCCTCTTTACAAGCAGATTTTTGGA
GCAGATCCTAATGAACAGCTGAAAAAGACGTTTGCTTGTTATCTTTCTACTGCGACTGGGCCTGTTGCTGGTACACTCTATCTGTCAACT
ACTAAAGTTGCTTTTTGCAGCGATCGGCCATTATCATACAAAGCTCCATCTGGTCAGGAGGCCTGGAGCTACTACAAGGTAGCAGTACCG
TTGGGAAATATTGGGACTATAAACCCAATAGTGATGAAAGAGTCTCCACCAGAGAGGTACATTCAGATTGTTACCATCGATGGTCATGAT
TTCTGGTTCATGGGGTTTGTGAATTTTGATAAAGCAAAACATCATCTACTTGAAACTTTGTCAATTTTTAGAGCACAACCCCCTCATCTC
AATCTGCAACAACCAGCAGCTACTXTACTAGAAGCATTGCCTGTACTCTGTTTTAGTGTGTTTTTTTTCCTGTTTGTTCCTGCATTAGAT
ATGTATTTGTATTTCTTTTATTGTAACATTCTTGTATGTTTATACATATTCGGGAGTGACTATGTTCGTTTTGATGTAAATAAAAGTTCT
TTGCGTTTTAATTTATTTGXTCTTGTTTTGATTGATATAGAAGATTTTGAXGATTTGAAGGTAAAAAAAAAGTTTGGGTGCACTGATGCA
ACCCAGGTCTTGGCTGAGGTGCAGGAGGCAAAGAAGGCTTACCCTCAGGCATGGGTCCGTATCATCGGATTCGACAATGTTCGTCAAGTG
CAGTGCATCAGTTTCATCGCTTACAAGCCCGAAGGATACTAA
Edits in Original Sequence 
GGCGATTGGCGGCCAAATCGGCCGAATTGGTATAATCTTATTACCGAAGCAAAAGAAAATGAAAACGCGTACACGTTCTACATAATCATC
ATCTATAAATTATTATAATTCCAATAACTGTGTATCTCTTAAGACAAAATTCACTCAAAATTCAACTACTCAAAGCAATTTACAATCAAT
TTCTCGAATC
(5')ATGACAGGCACAGGAGACGAAAATCAACCCAAATTTAAAAAATCAGAGTCTCAAATACCTTCTGTTTCTTCATCAT
CTTCAGATCCACAAGCACCAGAAATGGATCCCCAAAAATGGGGTACCCATATTATGGGTCCGCCTGCAGTTCCAACTTGTCATCCAGACA
ATCAGAAAGCTGCTTCATGGAGAGCTGAGGATCAAAGAGAAGAGTTTCAGCCACAGCCTTATGTTGTTTATTCCCCAATTGATAAGCCTA
GCAATAACCCACTTGATTCCGTTGTTAATGTGTTCAATTCATGGAGTAACAGAGCTGAGAACATAGCTCGCAACATTTGGTATAATCTGA
AAGCTGGACCGTCAGTTACAGAAGCGGCATGGGGAAAACTTAATTTGACAGCTAAGGCGTTGACAGAGGGTGGATTTGAGCCTCTTTACA
AGCAGATTTTTGGAGCAGATCCTAATGAACAGCTGAAAAAGACGTTTGCTTGTTATCTTTCTACTGCGACTGGGCCTGTTGCTGGTACAC
TCTATCTGTCAACTACTAAAGTTGCTTTTTGCAGCGATCGGCCATTATCATACAAAGCTCCATCTGGTCAGGAGGCCTGGAGCTACTACA
AGGTAGCAGTACCGTTGGGAAATATTGGGACTATAAACCCAATAGTGATGAAAGAGTCTCCACCAGAGAGGTACATTCAGATTGTTACCA
TCGATGGTCATGATTTCTGGTTCATGGGGTTTGTGAATTTTGATAAAGCAAAACATCATCTACTTGAAACTTTGTCAATTTTTAGAGCAC
AACCCCCTCATCTCAATCTGCAACAACCAGCAGCTACTXTACTAGAAGCATTGCCTGTACTCTGTTTTAGTGTGTTTTTTTTCCTGTTTG
TTCCTGCATTAGATATGTATTTGTATTTCTTTTATTGTAACATTaCTTGTATGTTTATACATATTCGGGAGTGACTATGTTCGTTTTGAT
GTAAATAAAAGTTCTTTGCGTTTTAATTTATTTGXTCTTGTTTTGAcTTGATATAGAAGATTTTGAXGATTTGAAGGTAAAAAAAAAGTT
TGGGTGCACTGATGCAACCCAGGTCTTGGCTGAGGTGCAGGAGGCAAAGAAGGCTTACCCTCAGGCATGGGTCCGTATCATCGGATTCGA
CAATGTTCGTCAAGTGCAGTGCATCAGTTTCATCGCTTACAAGCCCGAAGGATACTAA(3')AATGCCAATTTTTAATTATGTAATGTAT
AACTGACCCTATGTATTTAGGGGAAGCTTGTTTGAATCCTCCTTAAAGTTTTTCTCTGGAGAAACTGTAGTAATTTTACTTTGTTGTGTT
CCCTTCATCTTTTGAATTAATGGCATTTGTTTTAATACTATTTTTTTTTTTTTTTTCAAACATAGCATATAAGATTCAGACATTGAAAAT
AAATAAGCGTTACTACATAAAAAAGGAAGCAAGGAGTATTATTAAGGGAAAAGAATTAGTGTTTTGTTCATTTTTATATTTTTAAATAAT
TACTTTCAATAGAGGGAGAATTATAGTTGGAAATCAGATTCATCCCATTGAAGTACAGCAGAATCCAAATTTTGTTCTCTTTTAAGCTTA
TCTTTCAAGAACCAATCACATATTTTCCCAGCATTTAACTCTTCAATTGAACAACCTTCTTGTTCTCCTATCACTTTTAATAAATTGAGA
GATGAAATCGTCAATCGACATAGAAAACGTTCATGAGTGCTGAGGCCGGACACTTCAACAAGGCCAGCTTCTTCTAGTGTCAAAAAGGTA
CGCCTTTCACCATTATTTGCTTTCACTACTAAGCTTTGCATTTGCTTTTTTCTATAAGCAAATTTTAATGGTTCTACAACATAATTAGCA
TTTGCATTTTGATATTTGGAACTTATAAATGATGGTACTAATTGATGGTAATTTTCTCCACAAGTTTTGAGCATATTCATTGTTTGAACA
AAATGGGGAATAAAAAGATTGTTATGTTTTATTTTTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan