ESTScan Details for Unigene SGN-U580398

Score 
1071
Direction 
Forward
Predicted Peptide Sequence 
MAKIAVGSSREAIQPDCIQALIVEFICTFLFVFAGVGSAMAANKLNGDPLVSLFFVAMAHALVVAVTISAGFRISGGHLNPAVTLGLCMG
GHITVFRSILYWIDQLLASVAACALLNYLTDGMITPVHTLANGMSYGQGLIMEVILTFSLLFTVYTTLVDPKKGILEGMGPLLTGLVVGA
NIMAGGPFSGASMNPARSFGPAFVSGIWTDHWVYWIGPFIGGGLAGFICENFFIVRSHVPLPNEETF*
Predicted Coding Sequence 
ATGGCGAAAATTGCTGTTGGAAGTAGCCGTGAGGCTATTCAGCCTGATTGCATCCAAGCCCTCATTGTTGAATTTATTTGCACTTTTCTC
TTTGTTTTTGCTGGTGTTGGATCTGCCATGGCTGCAAATAAGCTAAATGGAGATCCACTAGTGAGTTTATTTTTTGTGGCAATGGCACAT
GCATTGGTGGTGGCTGTGACAATCTCTGCTGGTTTTCGTATTTCTGGTGGGCACCTTAACCCTGCTGTCACACTTGGCCTTTGTATGGGT
GGTCATATCACTGTCTTTAGATCAATCCTTTACTGGATTGACCAATTACTTGCTTCTGTTGCTGCTTGTGCTTTGCTCAATTACCTCACC
GATGGAATGATAACACCAGTTCACACCTTAGCAAATGGAATGAGCTATGGGCAGGGGTTAATTATGGAGGTGATTTTGACCTTTTCTTTG
TTGTTCACTGTGTATACAACACTTGTGGACCCCAAGAAAGGAATTCTTGAAGGAATGGGCCCACTTCTAACTGGGCTTGTTGTTGGGGCC
AATATTATGGCTGGTGGGCCTTTTTCAGGAGCTTCAATGAACCCAGCAAGGTCATTTGGGCCAGCTTTTGTAAGTGGAATCTGGACTGAC
CATTGGGTCTACTGGATTGGGCCTTTCATTGGTGGTGGGCTTGCTGGTTTTATTTGTGAAAACTTTTTCATTGTTAGGTCTCATGTTCCT
CTTCCAAATGAAGAGACTTTCTAG
Edits in Original Sequence 
GGCGATTGGCGGCCAATCGGCCGAATTCCATGGGGATCCGATGGCCACCCTAGCTAAATTAAATATTATTCTACGAGTGTGTATAAATAT
ATAGCTGTACATGGTCCTCCTCCGTTTTAAAAGCAAAAATAAAACCATTTCATTAATTTGACGAGAAATTAAA
(5')ATGGCGAAAATTG
CTGTTGGAAGTAGCCGTGAGGCTATTCAGCCTGATTGCATCCAAGCCCTCATTGTTGAATTTATTTGCACTTTTCTCTTTGTTTTTGCTG
GTGTTGGATCTGCCATGGCTGCAAATAAGCTAAATGGAGATCCACTAGTGAGTTTATTTTTTGTGGCAATGGCACATGCATTGGTGGTGG
CTGTGACAATCTCTGCTGGTTTTCGTATTTCTGGTGGGCACCTTAACCCTGCTGTCACACTTGGCCTTTGTATGGGTGGTCATATCACTG
TCTTTAGATCAATCCTTTACTGGATTGACCAATTACTTGCTTCTGTTGCTGCTTGTGCTTTGCTCAATTACCTCACCGATGGAATGATAA
CACCAGTTCACACCTTAGCAAATGGAATGAGCTATGGGCAGGGGTTAATTATGGAGGTGATTTTGACCTTTTCTTTGTTGTTCACTGTGT
ATACAACACTTGTGGACCCCAAGAAAGGAATTCTTGAAGGAATGGGCCCACTTCTAACTGGGCTTGTTGTTGGGGCCAATATTATGGCTG
GTGGGCCTTTTTCAGGAGCTTCAATGAACCCAGCAAGGTCATTTGGGCCAGCTTTTGTAAGTGGAATCTGGACTGACCATTGGGTCTACT
GGATTGGGCCTTTCATTGGTGGTGGGCTTGCTGGTTTTATTTGTGAAAACTTTTTCATTGTTAGGTCTCATGTTCCTCTTCCAAATGAAG
AGACTTTCTAG(3')GGTTTTGTAACAAAAGGCTCTTTATCTATTCTTGTAGTTTTGGAAGTCTACCTTATCTATGCATGTATTTTTTAT
GTTATCCTTTTTGTAACTTTATATTTTAATAATACTTTCGCTAGACTTGCTACGATTATTTCATTACGAAACTAAAGTACTAAACTACCC
CGTTTGGTCATGTGATATTGGTATCATGATATGAAATCAGAAGATGAAATTGAAGTTTTGTCTGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan