Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U580403

Score 
208
Direction 
Forward
Predicted Peptide Sequence 
XPIVEESNDKMSELKAFDDTKAGVKGLVDSGITKVPQIFVLPPKDRAKKCETHFVFPVIDLQGIDEDPIKHKEIVDKVRDASEKWGFFQV
VNHGIPTSVLDRTLQGTRQFFEQDNEVKKQYYTRDTAKKVVYTSNLDLYKSSVPAASWRDTIFCYMAPNPPSLQEFPTPWGKYFHFLVWR
FFSSSVAEADPPPGARAPINFVTEYIYIYVEINMYLYKINIEHPMNKDLVGPMAPDEYSVNTYFLYFQFKFLDXATAQLIDYLKTAKIPR
SVAAQLIEYXKYSKFLDPPLLXLIDYLKTSDFIKNMSCFNAXESLIDFSKDVKKLGFTLLELLSEGLGLDRSYLKDYMDCFHLFCSCNYY
PPCPQPELTMGTIQHTDIGFVTILLQDDMGGLQVLHQNHWVDVPPTPGSLVVNIGDFLQVSSDIIYKVYRATHLENLFFNYFLQLLSNDK
YLSVEHRAISNNVGSRMSITCFFGESPYQSSKLYGPITELLSEDNPPKYRANHSERPH*
Predicted Coding Sequence 
XGCCCTATAGTTGAGGAGAGTAATGACAAAATGAGTGAATTAAAAGCGTTTGATGATACTAAGGCCGGTGTTAAAGGACTTGTTGATTCT
GGAATTACTAAAGTACCTCAAATATTCGTTCTACCGCCAAAAGACAGGGCTAAAAAATGTGAAACACATTTCGTTTTTCCAGTGATAGAC
CTTCAAGGTATCGATGAGGATCCGATTAAGCATAAGGAGATAGTGGACAAAGTTCGAGATGCATCGGAGAAATGGGGTTTTTTCCAAGTG
GTTAATCATGGGATTCCAACATCCGTCTTGGACAGAACGTTGCAAGGAACACGACAGTTCTTTGAGCAAGATAACGAGGTTAAGAAACAG
TATTACACTCGAGATACTGCGAAAAAAGTGGTTTATACTAGCAATCTTGATTTGTATAAATCTTCTGTTCCAGCTGCAAGTTGGAGAGAC
ACGATTTTCTGTTACATGGCTCCGAATCCTCCCAGTCTACAAGAATTTCCAACTCCATGGGGTAAGTATTTTCATTTCTTAGTCTGGAGA
TTCTTTAGTAGCTCAGTGGCAGAGGCGGACCCTCCGCCGGGTGCTCGAGCACCCATTAATTTCGTTACGGAATATATATATATCTACGTA
GAAATTAATATGTATTTGTATAAAATTAACATAGAGCACCCAATGAATAAAGATTTAGTTGGCCCAATGGCTCCTGATGAATACTCTGTT
AACACATATTTTTTATATTTTCAGTTTAAATTTCTAGATXCCGCCACTGCTCAGTTGATTGACTATCTAAAGACAGCAAAAATTCCTAGA
TCTGTCGCTGCTCAGTTGATTGAGTATXCTAAATACAGCAAATTCTTAGATCCGCCATTGCTTAXGTTGATTGACTATCTAAAGACGTCT
GATTTTATTAAAAATATGTCATGTTTCAATGCAGXGGAGTCATTAATAGACTTCTCCAAGGATGTGAAGAAACTGGGATTCACTTTACTT
GAATTATTGTCTGAAGGTCTCGGTCTCGATCGTAGTTATCTCAAAGATTATATGGATTGTTTTCATCTTTTCTGTTCTTGCAACTACTAC
CCACCATGTCCTCAGCCAGAACTCACCATGGGCACCATTCAACATACCGATATTGGTTTTGTAACGATCCTTCTACAAGATGATATGGGA
GGGCTCCAAGTTCTTCACCAGAATCATTGGGTTGATGTTCCTCCTACACCCGGTTCTCTAGTGGTGAATATTGGAGATTTTCTGCAGGTT
AGTAGTGATATTATATACAAAGTTTATCGCGCAACACATTTAGAAAATCTTTTTTTTAATTATTTTTTGCAGCTCTTGTCAAATGACAAG
TACTTAAGTGTCGAGCACAGAGCAATCTCAAACAATGTTGGATCAAGAATGTCAATCACGTGCTTCTTCGGTGAAAGTCCATATCAATCT
TCCAAGCTTTATGGACCGATAACTGAATTGTTATCAGAAGATAATCCTCCAAAATATCGCGCXAACCACAGTGAAAGACCACACTAG
Edits in Original Sequence 
(5')XGCCCTATAGTTGAGGAGAGTAATGACAAAATGAGTGAATTAAAAGCGTTTGATGATACTAAGGCCGGTGTTAAAGGACTTGTTGA
TTCTGGAATTACTAAAGTACCTCAAATATTCGTTCTACCGCCAAAAGACAGGGCTAAAAAATGTGAAACACATTTCGTTTTTCCAGTGAT
AGACCTTCAAGGTATCGATGAGGATCCGATTAAGCATAAGGAGATAGTGGACAAAGTTCGAGATGCATCGGAGAAATGGGGTTTTTTCCA
AGTGGTTAATCATGGGATTCCAACATCCGTCTTGGACAGAACGTTGCAAGGAACACGACAGTTCTTTGAGCAAGATAACGAGGTTAAGAA
ACAGTATTACACTCGAGATACTGCGAAAAAAGTGGTTTATACTAGCAATCTTGATTTGTATAAATCTTCTGTTCCAGCTGCAAGTTGGAG
AGACACGATTTTCTGTTACATGGCTCCGAATCCTCCCAGTCTACAAGAATTTCCAACTCCATGcGGGTAAGTATTTTCATTTCTTAGTCT
GGAGATTCTTTAGTAGCTCAGTGGCAGAGGCGGACCCTCCGCCGGGTGCTCGAGCACCCATTAATTTCGTTACGGAATATATATATATCT
ACGTAGAAATTAATATGTATTTGTATAAAATTAACATAGAGCACCCAATGAATAAAcGATTTAGTTGGCCCAATGGCTCCTgGATGAATA
CTCTGTTAACACATATTTTTTATATTTTCAGTTTAAATTTCTAGATXCCGCCACTGCTCAGTTGATTGACTATCTAAAGACAGCAAAAAT
TCCTAGATCTGTCGCTGCTCAGTTGATTGAGTATXCTAAATACAGCAAATTCTTAGATCCGCCATTGCTTAXGTTGATTGACTATCTAAA
GACGTCTGATTTTATaTAAAAATATGTCATGTTTCAATGCAGXGGAGTCATTAATAGACTTCTCCAAGGATGTGAAGAAACTGGGATTCA
CTTTACTTGAATTATTGTCTGAAGGTCTCGGTCTCGATCGTAGTTATCTCAAAGATTATATGGATTGTTTTCATCTTTTCTGTTCTTGCA
ACTACTACCCACCATGTCCTCAGCCAGAACTCACCATGGGCACCATTCAACATACCGATATTGGTTTTGTAACGATCCTTCTACAAGATG
ATATGGGAGGGCTCCAAGTTCTTCACCAGAATCATTGGGTTGATGTTCCTCCTACACCCGGTTCTCTAGTGGTGAATATTGGAGATTTTC
TGCAGGTTAGTAGTcGATATTATATACAAAGTTTATCGCGCAACACATTTAGAAAATCTTTTTTTTAATTATTTTTTGCAGCTCTTGTCA
AATGACAAGTACTTAAGTGTCGAGCACAGAGCAATCTCAAACAATGTTGGATCAAGAATGTCAATCACGTGCTTCTTCGGTGAAAGTCCA
TATCAATCTTCCAAGCTTTATGGACCGATAACTGAATTGTTATCAGAAGATAATCCTCCAAAATATCGCGCXAACCACAGTGAAAGACCA
CACTAG(3')TTACCTCCATAACAGAGGCCTAGATGGAACTTCTGCATTGTCCCGTTACAAGATCTAAGAATAAGAATAATAATGTTATC
TATTATTACTATTTATACTTCTGCAGATTGTACCTTTGAATTTGAAGCAAATGTTTGAGTTAAATACTTTCACGTTTCTAAGCAATGTAA
TATAATTTATAAAGTAAAAAAAAAAAATGAACACATGAAATAAAAGAGACAACAAGATGAATTCCAAATTTCATCCTATCATATATGTCG
TGGGGGCTTAAAAAAACCCTTATAATCTATGTGTAGCATTTGAAAAAACTTGTGCTATGCTCCTATGGAGAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan