ESTScan Details for Unigene SGN-U580616

Score 
254
Direction 
Forward
Predicted Peptide Sequence 
KGTEKPSVWELIGIRFILLPYTLGKLLLWYGCWFWRYNVKHAPYSWEDASYLTRRSLRASLDSWISIDESTKEDLIERRLWEKSNFESYV
AEMRKESKPEDKKFLVLLKAMCRMRTVLMGEYSET*
Predicted Coding Sequence 
AAGGGCACCGAAAAGCCTTCTGTTTGGGAACTAATTGGAATCCGTTTTATACTTCTTCCTTACACTCTGGGAAAGCTGTTACTGTGGTAT
GGATGCTGGTTCTGGAGGTACAATGTCAAGCATGCTCCATATTCATGGGAAGATGCCTCCTATTTGACACGAAGGTCACTTCGGGCTTCT
CTTGATTCATGGATATCTATTGACGAATCAACCAAGGAAGATCTTATTGAAAGACGGCTTTGGGAGAAGTCCAACTTTGAAAGCTATGTG
GCTGAGATGCGCAAGGAATCAAAGCCCGAAGATAAAAAGTTTTTGGTTTTACTCAAAGCTATGTGTAGGATGAGAACAGTTTTGATGGGG
GAGTATTCTGAGACATGA
Edits in Original Sequence 
(5')AAGGGCACCGAAAAGCCTTCTGTTTGGGAACTAATTGGAATCCGTTTTATACTTCTTCCTTACACTCTGGGAAAGCTGTTACTGTG
GTATGGATGCTGGTTCTGGAGGTACAATGTCAAGCATGCTCCATATTCATGGGAAGATGCCTCCTATTTGACACGAAGGTCACTTCGGGC
TTCTCTTGATTCATGGATATCTATTGACGAATCAACCAAGGAAGATCTTATTGAAAGACGGCTTTGGGAGAAGTCCAACTTTGAAAGCTA
TGTGGCTGAGATGCGCAAGGAATCAAAGCgCCGAAGATAAAAAGTTTTTGGTTTTACTCAAAGCTATGTGTAGGATGAGAACAGTTTTGA
TGGGGGAGTATTCTGAGACATGA(3')AGCAGGAAGTCTAATGTTTAAATTATTGAAGAAAGCAAAATTATTTTGACAAGGAGAGCTATT
GAATTGATAAGTATGTCATAGAACTCGGATTTTCACGGTCAGTGTCATAGCTATATTAATAATACTATACAAAAAACATATTGAGACAGA
TACAAGCATATTGCATTTGGAGCAATTTTGGGGGAAGAGTGCTGCTCCCCACTTGCTGTTGTAATGCTAGGTTAGAATGTGTTGAAGCAT
CTATATGTTCTGAAAAGACAGGAACTCTGTTCCATATAATGAACTTCATACTTGGCTATGTTGTATTTGTATGTACCATAGTCTTAACTG
GTCAACTGTGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan