ESTScan Details for Unigene SGN-U580686

Score 
388
Direction 
Forward
Predicted Peptide Sequence 
MSGSPKKGGHGGKFTWAGDGSYSSKKEEADAAVVVDANDPNFDEPEENSIDES*
Predicted Coding Sequence 
ATGAGTGGATCTCCGAAGAAAGGCGGCCATGGTGGAAAGTTTACTTGGGCCGGCGACGGAAGTTATTCTTCTAAGAAAGAAGAAGCTGAT
GCTGCTGTTGTTGTCGACGCAAATGACCCTAATTTTGATGAACCGGAGGAGAATTCGATTGATGAATCGTAG
Edits in Original Sequence 
GGCAAGGATATTTTTGGGGGGTCAATTTTTTTCAAAGAAAACCCGGGGGTTTAAAAATTCCCATTTTGGGGGGCCAAAGGAAAAAAAATT
TGCCGTTCCCCTGGGGGTTTTTTTCGGGTTTTTTTTCCCAGGGGGGCCAAGGGGCCCTTTCCCCTATCTTTGTTTCCCCTGGGGGGAAAA
AAAAAAAAGCCAGGGGACTTTTNAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAANCTCACTGAAA
AAAAATAAAGTCACTATGAAAAACACATCAAAAAGTTCCAAAATTACCCCCAAATCAAGCCAAGATGCGAGAAAAGACCGGCGATCGGCC
ACCGGA
(5')ATGAGTGGATCTCCGAAGAAAGGCGGCCATGGTGGAAAGTTTACTTGGGCCGGCGACGGAAGTTATTCTTCTAAGAAAGA
AGAAGCTGATGCTGCTGTTGTTGTCGACGCAAATGACCCTAATTTTGATGAACCGGAGGAGAATTCGATTGATGAATCGTAG(3')ATTT
GCATTTCGAATGATTTGAATTGTTGATGTAAATATTGAAGAATTTGGTGATTTTATGCAGAATTTAGAGGGGAAAATTGGGAATGAAATG
GAAGGGAAGATCTGTTATCTGTGTTGTATTAACTTTTTGTTTTGATAAATAAAAATTTATTTTTTTCCCTCTAGAAAAAAAAAAATGACA
GCAACCAGATTAATCGAGGGGCGGCACAAAGCCCAAGTATCCCTATCGAGAGTCGGATTACAATT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan