ESTScan Details for Unigene SGN-U580688

Score 
411
Direction 
Forward
Predicted Peptide Sequence 
XVPKDAVEDWPEPKQVHSFYTVKFRRFDDPKLKARIELAEKELQKKNQARSQIIEKLKAKKIFTIVAALNWKYYKVKMKDLVXPTVLTNF
CKFSKLSAEKSIIIEQRKALSAENKEFRSAIDGKIKEMAPLHEALGQLRGSRNAGRERGPTVCSSEEELNHLIKGLQYRIQHESIPLNEE
KQILREIKQLEGTREDVKKVAAAX
Predicted Coding Sequence 
XXGGTTCCAAAGGATGCGGTTGAGGATTGGCCTGAACCTAAGCAGGTCCATTCGTTCTATACTGTTAAATTTCGGAGATTTGACGACCCT
AAACTGAAAGCCAGAATTGAACTGGCTGAAAAAGAGCTACAGAAAAAGAACCAAGCTAGATCTCAGATCATTGAAAAATTGAAGGCCAAA
AAGATTTTTACCATTGTTGCTGCGTTGAACTGGAAGTATTATAAAGTCAAAATGAAAGATCTTGTTXATCCTACAGTTTTAACTAATTTC
TGCAAATTCAGCAAGCTATCXGCTGAAAAATCAATTATCATTGAACAAAGGAAAGCCCTCAGTGCTGAGAATAAAGAATTTCGGAGTGCT
ATTGATGGTAAGATAAAGGAAATGGCACCTCTGCATGAGGCTTTGGGCCAGCTCCGCGGTTCTAGGAATGCAGGCCGAGAGAGGGGTCCT
ACAGTGTGTTCATCTGAGGAGGAGCTCAATCATCTTATCAAGGGTCTGCAATACCGCATTCAGCATGAAAGCATTCCTCTGAACGAAGAG
AAGCAAATTCTTCGGGAAATCAAACAACTTGAAGGAACAAGGGAAGATGTTAAAAAGGTTGCTGCTGCAAGX
Edits in Original Sequence 
(5')XXGGTTCCAAAGGATGCGGTTGAGGATTGGCCTGAACCTAAGCAGGTCCATTCGTTCTATACTGTTAAATTTCGGAGATTTGACGA
CCCTAAACTGAAAGCCAGAATTGAACTGGCTGAAAAAGAGCTACAGAAAAAGAACCAAGCTAGATCTCAGATCATTGAAAAATTGAAGGC
CAAAAAGATTTTTACCATgTGTTGCTGCGTTGAACTGGAAGTATTATAAAGTCAAAATGAAAGATCTTGTTXATCCTACAGTTTTAACTA
ATTTCTGCAAATTCAGCAAGCTATCXGCTGAAAAATCAATTATCATTGAACAAAGGAAAGCCCTCAGTGCTGAGAATAAAGAATTTCGGA
GTGCTATTGATGGTAAGATAAAGGAAATGGCACCTCTGCATGAGGCTTTGGGCCAGCTCCGCGGTTCTAGGAATGCAGGCCGAGAGAGGG
GTCCTACAGTGTGTTCATCTGAGGAGGAGCTCAATCATCTTATCAAGGGTCTGCAATACCGCATTCAGCATGAAAGCATTCCTCTGAACG
AAGAGAAGCAAATTCTTCGGGAAATCAAACAACTTGAAGGAACAAGGGAAGATGTTAAAAAGGTTGCTGCTGCAAGX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan