Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U580810

Score 
1435
Direction 
Forward
Predicted Peptide Sequence 
MDFQIYGFTNLFLFTITLFFTITSAAFQENPKSPISTVPQINSNSILVALLDSHYTELSELVEKALLLQTLEEAVSKHNITIFAPKNEAL
ERDLDPEFKRFLLEPGNLKSLQNLLLFHMIPTRIVSKNWPVRGRVHSTLYAGEENVLQISDKKTEKSVSSAKIIKQDDIVKPDGIIHGIE
RVLIPKSVQQDFNNRRSLRSISAVLPEGAPEVDPRTHRLKKPVSVPAGAPPVLPVYDALAPGPSLAPAPAPGPGGPHHHFDGESQVKDFI
QTLLHYGGYNELADILVNLTSLATEMGKLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEESMYNSVRRFGKINY
DTLRLPHKVVAEEADGSVKFGQGEGSAYLVDPDIYTDGRISVQGVDGVLFPLEEIKAAPVAKVVAKPRRGKLMEVVCGTMGSFAFASCH*
Predicted Coding Sequence 
ATGGATTTTCAGATCTATGGCTTCACTAATCTCTTTTTGTTCACCATTACACTCTTTTTCACCATTACAAGTGCCGCATTTCAAGAAAAC
CCAAAATCCCCAATTTCAACAGTACCCCAAATCAATTCCAACTCCATTCTTGTTGCCCTTTTGGATTCTCACTATACTGAGTTGTCTGAG
CTTGTTGAAAAAGCCCTTTTGCTTCAAACACTTGAAGAAGCTGTTTCTAAGCACAATATCACCATTTTTGCTCCTAAAAATGAAGCTCTG
GAACGCGATTTAGACCCTGAATTCAAGCGTTTCTTGCTTGAACCTGGTAATCTTAAATCTCTACAGAATCTCTTGTTGTTTCACATGATT
CCCACTCGCATTGTCTCCAAAAATTGGCCGGTGCGTGGCCGTGTTCACTCCACTTTATACGCCGGAGAAGAAAACGTCCTTCAAATCTCC
GATAAGAAAACAGAGAAATCAGTCAGCTCAGCTAAGATTATTAAACAAGACGATATCGTTAAACCCGACGGAATCATCCACGGTATTGAG
CGGGTTTTAATACCCAAATCAGTCCAGCAAGATTTCAACAACCGCCGTAGTCTCCGGTCAATCTCCGCCGTGCTACCGGAAGGAGCACCA
GAAGTTGACCCGAGAACCCACCGGTTGAAGAAACCCGTATCAGTACCTGCCGGTGCACCACCTGTGCTGCCGGTATATGATGCTTTGGCG
CCGGGGCCATCTCTGGCCCCGGCACCAGCTCCAGGACCCGGAGGACCCCACCATCATTTCGATGGTGAGAGTCAAGTAAAAGATTTCATT
CAAACACTACTACATTATGGTGGTTACAATGAATTAGCAGACATTCTTGTGAATCTCACATCATTAGCTACAGAAATGGGGAAATTGGTC
TCTGAAGGCTATGTTTTAACTGTTCTGGCGCCCAATGACGAGGCTATGGCTAAGCTGACAACTGATCAGCTTAGCGAGCCTGGGGCGCCT
GAACAGATAATGTATTACCATTTGATACCGGAGTATCAAACGGAAGAAAGTATGTATAATTCAGTGAGGAGATTTGGAAAAATTAATTAT
GATACTTTAAGGTTGCCACATAAAGTTGTGGCTGAAGAAGCTGATGGTTCAGTGAAATTCGGGCAAGGCGAAGGATCAGCTTATTTGGTT
GATCCTGATATTTATACTGATGGAAGAATCTCTGTGCAAGGGGTTGATGGTGTTTTGTTCCCTCTTGAGGAAATTAAGGCTGCTCCTGTT
GCTAAAGTTGTTGCAAAGCCAAGAAGAGGAAAGTTGATGGAAGTAGTATGTGGTACAATGGGGTCATTTGCTTTTGCTAGTTGTCATTAA
Edits in Original Sequence 
CTACTATACACTTCCCATTTCCCCCCCTTCTTTACTAACAACAAAGCCAAAGTCCATAACACCCACAAATTCACTCAACCCAACATAACA
CGTTGTTCTACCGACACTCTCCAAGAACAAGAGAGAGAAAACAGAGAGAATTGAGAGAGAAAGCTTCAATCTTTAGCC
(5')ATGGATTT
TCAGATCTATGGCTTCACTAATCTCTTTTTGTTCACCATTACACTCTTTTTCACCATTACAAGTGCCGCATTTCAAGAAAACCCAAAATC
CCCAATTTCAACAGTACCCCAAATCAATTCCAACTCCATTCTTGTTGCCCTTTTGGATTCTCACTATACTGAGTTGTCTGAGCTTGTTGA
AAAAGCCCTTTTGCTTCAAACACTTGAAGAAGCTGTTTCTAAGCACAATATCACCATTTTTGCTCCTAAAAATGAAGCTCTGGAACGCGA
TTTAGACCCTGAATTCAAGCGTTTCTTGCTTGAACCTGGTAATCTTAAATCTCTACAGAATCTCTTGTTGTTTCACATGATTCCCACTCG
CATTGTCTCCAAAAATTGGCCGGTGCGTGGCCGTGTTCACTCCACTTTATACGCCGGAGAAGAAAACGTCCTTCAAATCTCCGATAAGAA
AACAGAGAAATCAGTCAGCTCAGCTAAGATTATTAAACAAGACGATATCGTTAAACCCGACGGAATCATCCACGGTATTGAGCGGGTTTT
AATACCCAAATCAGTCCAGCAAGATTTCAACAACCGCCGTAGTCTCCGGTCAATCTCCGCCGTGCTACCGGAAGGAGCACCAGAAGTTGA
CCCGAGAACCCACCGGTTGAAGAAACCCGTATCAGTACCTGCCGGTGCACCACCTGTGCTGCCGGTATATGATGCTTTGGCGCCGGGGCC
ATCTCTGGCCCCGGCACCAGCTCCAGGACCCGGAGGACCCCACCATCATTTCGATGGTGAGAGTCAAGTAAAAGATTTCATTCAAACACT
ACTACATTATGGTGGTTACAATGAATTAGCAGACATTCTTGTGAATCTCACATCATTAGCTACAGAAATGGGGAAATTGGTCTCTGAAGG
CTATGTTTTAACTGTTCTGGCGCCCAATGACGAGGCTATGGCTAAGCTGACAACTGATCAGCTTAGCGAGCCTGGGGCGCCTGAACAGAT
AATGTATTACCATTTGATACCGGAGTATCAAACGGAAGAAAGTATGTATAATTCAGTGAGGAGATTTGGAAAAATTAATTATGATACTTT
AAGGTTGCCACATAAAGTTGTGGCTGAAGAAGCTGATGGTTCAGTGAAATTCGGGCAAGGCGAAGGATCAGCTTATTTGGTTGATCCTGA
TATTTATACTGATGGAAGAATCTCTGTGCAAGGGGTTGATGGTGTTTTGTTCCCTCTTGAGGAAATTAAGGCTGCTCCTGTTGCTAAAGT
TGTTGCAAAGCCAAGAAGAGGAAAGTTGATGGAAGTAGTATGTGGTACAATGGGGTCATTTGCTTTTGCTAGTTGTCATTAA(3')AATT
TGTATACTTGAGGAAATTGTGAAGATAAAAAAATGAAAAAAAAGCATGGTGAGTGTCTCAAAATATATGTATAATTAGAATAAATAAATA
AATAATTGGGACCTTAAATAAATAAAAAGCTTACTTCTTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan