ESTScan Details for Unigene SGN-U580880

Score 
680
Direction 
Forward
Predicted Peptide Sequence 
MVRWVLPVNVSNQYNHCGDKLEAVPSLYISVAHLVVVDYTTVFLFRLLMFVDNGLAAGMGLDLGWQQRYSAFXGRIVVLSILALFLYPFL
WAWTIIGTLWFTSGETVCQKKVKSGVSLFGCCSATXGLIGIACISIGKWLTRRQAHSLRAQQGIPTXRIWGAGDMIRVPDWTFAAAGQEM
RAMGPDATSYHPGLYLTQAQTEAVEALIQELPKFCLKAVPTDCSECPICLEEFRMGNEVRGLPCAHNFHVECIDEWLRLNVKCPRCRSSV
FPNLDLSALSNIRTDSEGSTANVVTAAQYXEIPTLQPELSAKNARFAPPCTTQDAGLGSEVDPADSSNQASTPHXSRIRGTSTSYSGTVP
KGAITILPEEVLYLKCLNLMIPXQLVAIVKCSKWFLIATKFRQLEMW
Predicted Coding Sequence 
ATGGTACGATGGGTTCTTCCTGTCAATGTTAGCAACCAGTATAATCATTGTGGCGATAAATTGGAAGCGGTACCATCTTTGTATATATCC
GTTGCACATTTGGTTGTGGTTGACTACACAACAGTGTTTCTTTTTCGTCTCTTGATGTTTGTTGATAATGGACTTGCTGCTGGAATGGGA
TTGGATTTGGGTTGGCAGCAGAGATACAGTGCTTTCXGTGGAAGAATAGTTGTTCTTTCAATTCTTGCCCTGTTTCTGTATCCTTTTCTT
TGGGCTTGGACCATTATCGGGACTTTATGGTTCACTAGTGGAGAAACTGTTTGCCAGAAGAAGGTCAAAAGTGGGGTTTCCTTATTTGGT
TGCTGTTCAGCTACTGXTGGACTCATTGGCATAGCTTGCATATCAATTGGGAAGTGGTTAACTAGAAGGCAAGCCCATTCTTTACGTGCT
CAACAAGGGATTCCTACTTNCCGAATTTGGGGTGCTGGTGACATGATCAGAGTGCCAGATTGGACTTTTGCAGCAGCAGGGCAGGAGATG
AGAGCAATGGGCCCTGATGCTACTTCTTATCATCCAGGACTTTACTTAACCCAAGCTCAGACAGAAGCAGTGGAAGCACTCATTCAGGAA
CTGCCAAAGTTCTGCCTGAAGGCTGTTCCTACTGACTGTAGCGAGTGCCCTATCTGTTTGGAAGAGTTTCGCATGGGAAATGAGGTTCGT
GGTCTGCCTTGTGCTCACAACTTTCACGTGGAATGCATTGATGAATGGCTTCGCCTAAACGTGAAATGCCCTAGATGCCGCTCTTCTGTC
TTTCCAAATCTTGATCTCAGTGCTTTATCCAATATCCGAACCGATTCAGAGGGGTCAACAGCCAATGTTGTGACAGCAGCACAGTATGXT
GAGATCCCAACCCTCCAGCCAGAGCTATCTGCTAAGAATGCAAGGTTTGCTCCGCCCTGTACCACACAAGATGCTGGCCTGGGCAGTGAG
GTAGATCCAGCTGATAGCAGCAACCAAGCATCCACACCTCATAXGTCACGGATTCGTGGAACCAGTACAAGTTATAGTGGAACAGTCCCC
AAGGGAGCTATAACCATACTTCCTGAGGAGGTTCTTTACCTCAAATGTCTTAACTTGATGATTCCTAAXCAACTTGTAGCCATTGTCAAG
TGTTCAAAGTGGTTTCTCATTGCAACCAAATTTCGTCAATTAGAAATGTGG
Edits in Original Sequence 
TAGTCTGGAGAATTCTTTACTTTCCCTTTTTCACGACAGCCTTCAAAATCTGTACAAAATTGTTCCTTCAATACATATCTACTCATCGAT
CCCTGAACGGTAGCATTACCGGAGAATAAAAAAGTTCGAATTTTTCTCAGTTTGGTCGCTCCAATTTCAAACATTTGCTTACTGAAATGA
AAGGGGCAGATTTTAA
(5')ATGGTACGATGGGTTCTTCCTGTCAATGTTAGCAACCAGTATAATCATTGTGGCGATAAATTGGAAGCGG
TACCATCTTTGTATATATCCGTTGCACATTTGGaTTGTGGTTGACTACACAACAGTGTTTCTTTTTCGTCTCTTGATGTTTGTTGATAAT
GGACTTGCTGCTGGAATGGGATTGGATTTGGGTTGGCAGCAGAGATACAGTcGCTTTCXGTGGAAGAATAGTTGTTCTTTCAATTCTTGC
CCTGTTTCTGTATCCTTTTCTTTGGGCTTGGACCATTATCGGGACTTTATGGTTCACTAGTGcGAGAAACTGTTTGCCAGAAGAAGGTCA
AAAGTGGGGTTTCCTTATTTGGTTGCTGTTCAGCTACTGXTGGACTCATTGGCATAGCTTGCATATCAATTGGGAAGTGGTTAACTAGAA
GGCAAGCCCATTCTTTACGTGCTCAACAAGGGATTCCTACTTNCCGAATTTGGGGTGCTGGtTGACATGATCAGAGTGCCAGATTGGACT
TTTGCAGCAGCAGGGCAGGAGATGAGAGCAATGGGCCCTGATGCTACTTCTTATCATCCAGGACTTTACTTAACCCAAGCTCAGACAGAA
GCAGTGGAAGCACTCATTCAGGAACTGCCAAAGTTCTGCCTGAAGGCTGTTCCTACTGACTGTAGCGAGTGCCCTATCTGTTTGGAAGAG
TTTCGCATGGGAAATGAGGTTCGTGGTCTGCCTTGTGCTCACAACTTTCACGTGGAATGCATTGATGAATGGCTTCGCCTAAACGTGAAA
TGCCCTAGATGCCGCTCTTCTGTCTTTCCAAATCTTGATCTCAGTGCTTTATCCAATATCCGAACCGATTCAGAGGGGTCAACAGCCAAT
GTTGTGACAGCAGCACAGTATGXTGAGATCCCAACCCTCCAGCCAGAGCTATCTGCTAAGAATGCAAGGTTTGCTCCGCCCTGTACgCAC
ACAAGATGCTGGCCTGGGCAGTGAGGTAGATCCAGCTGATAGCAGCAACCAAGCATCCACACCTCATAXGTCACGGATTCGTGGAACCAG
TACAAGTTATAGTGGAACAGTCCCCAAGGGAGCTATAACCATACTTCCTGAGGAGGTTCTTTACCTCAAATGTCTTAACTTGATGATTCC
TAAXCAACTTGTAGCCATTGTCAAGTGTTCAAAGTGGTTTCTCATTGCAACCAAATTTCGTCAATTAGAAATGTGG(3')TAGCAATGAT
TTATGTTCACAGCCAGCTTGTTCTGATGGAACAATATATGTTTGTTTTACCACGAGTCATATCGATTAATTCATATACTGTTTTTTTCTG
TGTTTAAATGAACCTTCAAGACTTTGTTTCCCATTACTAAAACTGTATAAGTAACACAATCTGGTGCTACTTGTTAATACTAAAGTAGTT
ATATATGGTTTCCAATTCTTATCAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan