Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U580994

Score 
400
Direction 
Reverse
Predicted Peptide Sequence 
MILLIHTSIEXRVVDLRPRSSFFEFKLLNPPNNIHLQQNLDITSIASNGGRVSCMQVWPPINMKKYETLSYLPDLSDEQLLSEIEYLLKN
GWVPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPEGY*
Predicted Coding Sequence 
ATGATCCTCCTCATTCATACTTCCATTGAAGXTAGAGTTGTTGATCTTCGTCCTCGTTCXTCCTTTTTTGAATTCAAATTGTTGAATCCA
CCGAATAATATCCATCTTCAGCAAAACCTTGACATTACCTCCATTGCTAGCAACGGTGGAAGAGTCAGTTGCATGCAGGTGTGGCCACCA
ATTAACATGAAGAAGTACGAGACTCTGTCGTACCTTCCTGATTTGTCCGACGAGCAATTGCTCAGCGAAATTGAGTACCTATTGAAAAAT
GGATGGGTTCCTTGCTTGGAATTCGAGACTGAGCACGGATTTGTGTACCGTGAGAACCATAAGTCACCAGGATACTACGATGGCAGATAC
TGGACCATGTGGAAGTTGCCCATGTTTGGGTGCACTGATGCAACCCAGGTCTTGGCTGAGGTGCAGGAGGCAAAGAAGGCTTACCCTCAG
GCATGGGTCCGTATCATCGGATTCGACAATGTTCGTCAAGTGCAGTGCATCAGTTTCATCGCTTACAAGCCCGAAGGATACTAA
Edits in Original Sequence 
AAAAAGCCGGAGCCCCACCCCCGTGGCGGCCGCCCCAAAACTTGTGGATCCCCCGGGCTGCCGGAAAAAAAAAAAACATAATATTAATGT
ATTGATTTCTATATGGTGAGGAGAGCATTGATTATCTGAACTTTCTCCGAGTTCTACGCGTACTATACATATATCAGTTTCTAGAGGTGT
CACAACTAAAAGAGATGATTGTAATTTTAACTTTGCCAAGTTTTATGATTTTTAACTTCAGTATTAACAAGAGCAGCAATGTTGAAAATG
TCATCACTGTGAGAGAGAGGTTTTAACCCCAAGAAATCTTTGGTTAATAT
(5')ATGATCCTCCTCATTCATACTTCCATTGAAGXTAGA
GTTGTTGATCTTCGTCCTCGTTCXTCCTTTTTTGAATTCAAATTGTTGAATCCACCGAATAATATCgCATCTTCAGCAAAACCTTGACAT
TACCTCCATTGCTAGCAACGGTGGAAGAGTCAGTTGCATGCAGGTGTGGCCACCAATTAACATGAAGAAGTACGAGACTCTGTCGTACCT
TCCTGATTTGTCCGACGAGCAATTGCTCAGCGAAATTGAGTACCTATTGAAAAATGGATGGGTTCCTTGCTTGGAATTCGAGACTGAGCA
CGGATTTGTGTACCGTGAGAACCATAAGTCACCAGGATACTACGATGGCAGATACTGGACCATGTGGAAGTTGCCCATGTTTGGGTGCAC
TGATGCAACCCAGGTCTTGGCTGAGGTGCAGGAGGCAAAGAAGGCTTACCCTCAGGCATGGGTCCGTATCATCGGATTCGACAATGTTCG
TCAAGTGCAGTGCATCAGTTTCATCGCTTACAAGCCCGAAGGATACTAA(3')AATGCCAATTTTTAATTATGTAATGTATAACTGACCC
TATGTATTTAGGGGAAGCTTGTTTGAATCCTCCTTAAAGTTTTTCTCTGGAGAAACTGTAGTAATTTTACTTTGTTGTGTTCCCTTCATC
TTTTGAATTAATGGCATTTGTTTTAATACT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan