ESTScan Details for Unigene SGN-U580998

Score 
1659
Direction 
Forward
Predicted Peptide Sequence 
VGVKSKVARFMRKVVKKLVNRKXFTVLHSPPTVRQIHNAEIVADKAKTLINRSRTTCSSSFPPPIITSTSVLQRLTSSSSSSSQSTAVLR
FLSTSSDSMASDYSSTPVTLNNVNPKVLKCEYAVRGEIVNLAQKLQQDLKENPGSHPFDEILYCNIGNPQSLAQQPITFFREVLALCDHP
LILDKSETQGLFSADSIERAFQILDQIPGRATGAYSHSQGIKGLRDTIASGIEARDGFPADPNDIFLTDGASPAVHMMMQLLIGSENDGI
LCPIPQYPLYSASIALHGGTLVPYYLDEETGWGLEVSELENQLKTAKSKGINVRALAVINPGNPTGQVLAEANQREIVEFCKKEGLVLLA
DEVYQENVYVPEKQFHSFKKVARSMGFGEKDISLVSFQSVSKGFYGECGKRGGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASLVM
SPPKVGDESYESFAAEKEGILSSLARRAKTLEDAFSNLEGVTCNKAEGAMYLFPRINLPDKAIKAAEEAKIAPDAFYARHLLNATGIVVV
PGSGFGQRPGTWHFRCTILPQEEKIPAIVSRLTEFHKLFMDEFAAKESGGTFYWRLDHRKFLKAIFVCFISILTKNNYVSVVKADIGLFG
TYKLAIVYSSILDLT*
Predicted Coding Sequence 
GTGGGCGTCAAGTCAAAAGTGGCTCGATTTATGCGAAAAGTGGTAAAAAAGTTGGTGAATCGTAAAXCGTTCACCGTTCTTCACTCTCCG
CCCACTGTTCGCCAAATCCATAATGCGGAGATTGTTGCTGATAAAGCCAAAACTCTCATCAATAGGAGCAGGACCACCTGTTCGTCTTCT
TTTCCTCCTCCTATTATTACTTCTACTTCCGTGTTGCAGCGGCTCACCTCTTCTTCTTCTTCTTCATCTCAATCAACTGCTGTTCTTCGT
TTTTTATCCACTTCTTCTGATTCAATGGCTTCCGATTATTCATCCACTCCGGTCACTCTTAACAACGTTAACCCAAAGGTTTTGAAATGT
GAATATGCTGTCCGAGGAGAAATAGTCAACCTTGCTCAGAAATTACAACAAGACCTCAAGGAGAATCCAGGCTCTCATCCCTTTGATGAG
ATCTTATACTGCAATATTGGAAATCCTCAATCCCTGGCTCAGCAGCCTATTACTTTCTTTAGGGAGGTCCTTGCATTATGTGATCATCCA
CTTATTTTGGACAAAAGTGAAACTCAAGGTTTGTTCAGTGCGGATTCAATAGAACGAGCTTTTCAGATCCTCGACCAAATTCCTGGTAGA
GCAACAGGTGCATACAGCCACAGTCAGGGTATCAAAGGATTACGTGATACAATTGCTTCTGGTATCGAAGCTCGTGATGGCTTCCCTGCC
GATCCAAATGATATTTTCTTGACTGATGGTGCAAGCCCTGCGGTTCACATGATGATGCAGTTGCTCATCGGGTCAGAGAATGACGGAATT
CTCTGTCCCATCCCCCAATATCCTCTTTATTCTGCTTCGATTGCTCTCCATGGTGGCACTCTCGTTCCTTATTATCTTGATGAGGAAACA
GGATGGGGACTTGAGGTCTCAGAGCTTGAGAATCAGCTGAAAACTGCAAAATCTAAGGGTATTAACGTTAGGGCTTTGGCTGTGATCAAT
CCAGGCAACCCAACTGGGCAGGTTCTCGCTGAGGCTAACCAACGAGAAATTGTGGAATTCTGCAAGAAAGAAGGCCTTGTTCTTCTGGCG
GATGAAGTGTATCAGGAAAATGTTTATGTGCCTGAGAAGCAGTTCCACTCATTTAAGAAAGTTGCCCGCTCTATGGGATTTGGAGAAAAG
GACATCTCTTTAGTTTCTTTTCAGTCTGTGTCTAAAGGATTCTATGGAGAGTGTGGAAAGCGAGGAGGTTACATGGAGGTTACTGGATTT
AGCCCTGAGATAAGAGAACAGATATACAAAGTGGCATCTGTCAATCTGTGTTCCAACATTTCTGGTCAGATTCTTGCGAGCCTTGTCATG
AGCCCTCCGAAGGTGGGTGATGAATCATACGAGTCTTTTGCTGCTGAGAAAGAAGGGATACTTTCATCCTTGGCAAGACGTGCAAAGACA
CTAGAAGATGCATTCAGTAATTTGGAGGGAGTAACATGCAATAAAGCAGAGGGTGCAATGTATCTATTTCCACGTATCAACTTACCTGAC
AAAGCAATAAAAGCAGCAGAAGAAGCTAAAATTGCACCAGATGCATTTTATGCTCGGCACCTCCTTAATGCTACCGGAATTGTTGTTGTC
CCAGGCTCTGGATTTGGCCAGCGTCCTGGAACGTGGCATTTTAGGTGCACAATATTACCGCAAGAAGAGAAGATACCAGCTATTGTATCT
CGTCTTACAGAATTCCATAAGCTGTTCATGGATGAATTCGCGGCTAAGGAGTCTGGGGGTACATTCTATTGGAGACTTGATCATAGAAAA
TTTTTAAAAGCCATCTTTGTATGTTTTATTTCCATTCTCACCAAAAACAATTATGTTTCAGTAGTGAAAGCTGATATAGGATTGTTTGGC
ACATACAAGTTGGCGATTGTTTATTCTTCTATTTTGGACTTGACTTGA
Edits in Original Sequence 
GGGCGGCGATTGGGTGGTCGCCATCGTCAGAATACCCATAGACTACTTCTCTATTAAAAATAAAATATCTTCGCCAATCAGAGTCAAGAT
AGGGTACTAATTCTCTGCTAAAAAC
(5')GTGGGCGTCAAGTCAAAAGTGcGCTCGATTTATGCGAAAAGTGGTAAAAAAGTTGGTGAAT
CGTAAAXCGTTCACCGTTCTTCACTCTCCGCCCACTGTTCGCCAAATCCATAATGCGGAGATTcGTTGCTGATAAAGCCAAAACTCTCAT
CAATAGGAGCAGGACCACCTGTTCGTCTTCTTTTCCTCCTCCTATTATTACTTCTACTTCCGTGTTGCAGCGGCTCACCTCTTCTTCTTC
TTCTTCATCTCAATCAACTGCTGTTCTTCGTTTTTTATCCACTTCTTCTGATTCAATGGCTTCCGATTATTCATCCACTCCGGTCACTCT
TAACAACGTTAACCCAAAGGTTTTGAAATGTGAATATGCTGTCCGAGGAGAAATAGTCAACCTTGCTCAGAAATTACAACAAGACCTCAA
GGAGAATCCAGGCTCTCATCCCTTTGATGAGATCTTATACTGCAATATTGGAAATCCTCAATCCCTGGCTCAGCAGCCTATTACTTTCTT
TAGGGAGGTCCTTGCATTATGTGATCATCCACTTATTTTGGACAAAAGTGAAACTCAAGGTTTGTTCAGTGCGGATTCAATAGAACGAGC
TTTTCAGATCCTCGACCAAATTCCTGGTAGAGCAACAGGTGCATACAGCCACAGTCAGGGTATCAAAGGATTACGTGATACAATTGCTTC
TGGTATCGAAGCTCGTGATGGCTTCCCTGCCGATCCAAATGATATTTTCTTGACTGATGGTGCAAGCCCTGCGGTTCACATGATGATGCA
GTTGCTCATCGGGTCAGAGAATGACGGAATTCTCTGTCCCATCCCCCAATATCCTCTTTATTCTGCTTCGATTGCTCTCCATGGTGGCAC
TCTCGTTCCTTATTATCTTGATGAGGAAACAGGATGGGGACTTGAGGTCTCAGAGCTTGAGAATCAGCTGAAAACTGCAAAATCTAAGGG
TATTAACGTTAGGGCTTTGGCTGTGATCAATCCAGGCAACCCAACTGGGCAGGTTCTCGCTGAGGCTAACCAACGAGAAATTGTGGAATT
CTGCAAGAAAGAAGGCCTTGTTCTTCTGGCGGATGAAGTGTATCAGGAAAATGTTTATGTGCCTGAGAAGCAGTTCCACTCATTTAAGAA
AGTTGCCCGCTCTATGGGATTTGGAGAAAAGGACATCTCTTTAGTTTCTTTTCAGTCTGTGTCTAAAGGATTCTATGGAGAGTGTGGAAA
GCGAGGAGGTTACATGGAGGTTACTGGATTTAGCCCTGAGATAAGAGAACAGATATACAAAGTGGCATCTGTCAATCTGTGTTCCAACAT
TTCTGGTCAGATTCTTGCGAGCCTTGTCATGAGCCCTCCGAAGGTGGGTGATGAATCATACGAGTCTTTTGCTGCTGAGAAAGAAGGGAT
ACTTTCATCCTTGGCAAGACGTGCAAAGACACTAGAAGATGCATTCAGTAATTTGGAGGGAGTAACATGCAATAAAGCAGAGGGTGCAAT
GTATCTATTTCCACGTATCAACTTACCTGACAAAGCAATAAAAGCAGCAGAAGAAGCTAAAATTGCACCAGATGCATTTTATGCTCGGCA
CCTCCTTAATGCTACCGGAATTGTTGTTGTCCCAGGCTCTGGATTTGGCCAGCGTCCTGGAACGTGGCATTTTAGGTGCACAATATTACC
GCAAGAAGAGAAGATACCAGCTATTGTATCTCGTCTTACAGAATTCCATAAGCTGTTCATGGATGAATTcCGCGGCTAAGGAGTCTGGGG
GTACATTCTATTGGAGACTTGATCATAGAAAATTTTTAAtAAGCCATCTTTGTATGTTTTATTTCCATTCTCACCAAAAACAATTATGTT
TCAGTAGTGAAAGCTGATATAGGATTGTTTGGCACATACAAGTTGGCGATTGTTTATTCTTCTATTTTGGACTTGACTTGA(3')CATTG
ATCCTCTCTCCTAGATGATCAATGTGAAGATTGTTTTGTATACCAAACAGGTAAAGCTTTTGCAATCTTATTTTTAACGCAGGCAGTGTT
TGTCACTTCCAACTGGTATCAAGTCCAGTTTTATATC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan