ESTScan Details for Unigene SGN-U581004

Score 
384
Direction 
Forward
Predicted Peptide Sequence 
MYLRTPIDRVLFSPSNPQFSRTQKVSFRVNSKLNNNVIEISESKSFYELLGIQETVSLLEIKQAYKQLARKYHPDVSPPGRVEENTQRFI
RVQEAYETLSDPKSRDMYDKHMSKGLHFAFSPRRKCQNDESMENTGEWKNRWHSQLSELKRRNSHKDSGNNMSWGAHMRRQRSETSL*
Predicted Coding Sequence 
ATGTATCTAAGAACCCCAATAGATCGTGTCCTATTTTCCCCATCAAATCCCCAATTTTCAAGAACTCAAAAAGTGTCTTTTAGAGTAAAC
TCAAAACTTAACAACAATGTGATAGAAATTAGTGAATCAAAAAGCTTTTATGAGCTTTTGGGTATTCAAGAAACTGTTTCTTTATTAGAA
ATTAAACAAGCGTACAAACAATTAGCAAGAAAGTACCACCCAGATGTTTCACCTCCGGGTCGGGTCGAAGAAAATACCCAAAGGTTTATT
CGGGTTCAAGAGGCTTATGAGACATTATCGGATCCTAAATCAAGAGATATGTATGACAAACATATGTCTAAAGGACTTCATTTTGCATTT
TCTCCTCGTAGAAAGTGCCAAAATGATGAGTCAATGGAGAACACCGGTGAATGGAAGAATCGATGGCATTCTCAGCTATCGGAGTTGAAA
AGAAGAAACTCACACAAGGACTCTGGTAACAATATGTCATGGGGTGCACATATGCGTAGACAAAGGAGTGAAACATCGTTATAA
Edits in Original Sequence 
GAAAGAAAAAA(5')ATGTATCTAAGAACCCCAATAGATCGTGTCCTATTTTCCCCATCAAATCCCCAATTTTCAAGAACTCAAAAAGTG
TCTTTTAGAGTAAACTCAAAACTTAACAACAATGTGATAGAAATTAGTGAATCAAAAAGCTTTTATGAGCTTTTGGGTATTCAAGAAACT
GTTTCTTTATTAGAAATTAAACAAGCGTACAAACAATTAGCAAGAAAGTACCACCCAGATGTTTCACCTCCGGGTCGGGTCGAAGAAAAT
ACCCAAAGGTTTATTCGGGTTCAAGAGGCTTATGAGACATTATCGGATCCTAAATCAAGAGATATGTATGACAAACATATGTCTAAAGGA
CTTCATTTTGCATTTTCTCCTCGTAGAAAGTGCCAAAATGATGAGTCAATGGAGAACACCGGTGAATGGAAGAATCGATGGCATTCTCAG
CTATCGGAGTTGAAAAGAAGAAACTCACACAAGGACTCTGGTAACAATATGTCATGGGGTGCACATATGCGTAGACAAAGGAGTGAAACA
TCGTTATAA(3')CGAATTATATAGTTTTTATATATTGCTTATATATAATTTGAAGTGTTTGGTTAAGCATTGATGTTATAAGTAGTGTA
ACAACTATATGTAAGTGCTGACCAAATATAGGTAACTGTTTGTACATAAGAGTTCTTTGAATCAAGTTTTTTTTTTAGATTCGAGTTATA
GTTCTGGGGTGGGAATTAAACTAGGTTGAAATAAGAAAAATGGAGACACCAATTACCTTGTTGATTTTACCCAAAATTACATGACTGCTC
CAATGTTTGGTTTACCTGTCAAGTAGTGTTAGCATTTGGGCTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan