Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U581072

Score 
645
Direction 
Forward
Predicted Peptide Sequence 
MEKDLAGSTEENELGGGSNNGDQWDWTTSFVLFGLWSGLMYYVFFLAPNQTPLTDVYFLKKLLNLKGDDGFRMNEVLVGLWYIMGLWPLV
YSMLLLPTARSSKGGIPVWPFLVLSCFGGAYVLIPYFALWKPPPPPVEETELQRLPLNLLESKLTAGGLGIIFYAGLSSGDVWKEFYQYF
RESRFVHATSIDFSLLSVFAPFWIYNDMTAPKWYDKGSWLLPLSVIPFLGPALYLLLRPSLPTVPALSSPTSLRKNDTDFLHKDSTSMVH
*
Predicted Coding Sequence 
ATGGAAAAAGATTTAGCTGGTTCTACAGAGGAGAATGAGCTTGGTGGTGGAAGTAATAATGGAGACCAATGGGATTGGACGACGTCGTTT
GTACTGTTTGGCTTGTGGTCTGGACTCATGTACTATGTTTTCTTCCTTGCTCCTAACCAGACCCCGTTGACAGACGTGTATTTCTTAAAA
AAGCTCCTTAATTTGAAAGGAGATGATGGATTCCGTATGAATGAAGTGCTAGTGGGACTTTGGTATATCATGGGTTTATGGCCATTAGTT
TACAGTATGCTGCTCCTTCCTACTGCTAGAAGTTCAAAAGGCGGCATTCCTGTTTGGCCTTTTCTTGTACTTTCATGCTTTGGTGGTGCA
TATGTTCTCATTCCTTATTTTGCTCTCTGGAAACCACCACCTCCACCTGTTGAAGAAACTGAGCTTCAAAGGTTACCTTTGAATTTGCTT
GAATCTAAGCTAACAGCAGGGGGXCTAGGGATAATATTTTATGCAGGTTTATCGAGTGGAGATGTCTGGAAGGAATTTTACCAATACTTC
AGAGAAAGCAGATTCGTCCATGCGACGTCGATTGATTTCAGTTTACTATCGGTATTTGCACCCTTCTGGATTTACAATGATATGACTGCT
CCAAAGTGGTATGACAAAGGATCTTGGCTTCTTCCGCTGTCGGTGATCCCTTTTTTGGGTCCAGCACTATACCTTCTCCTACGCCCATCT
CTTCCAACAGTACCAGCCTTATCAAGCCCAACTTCACTGAGGAAAAATGATACAGATTTCTTACACAAGGATTCTACTAGCATGGTACAT
TGA
Edits in Original Sequence 
GCTGCATTTTTCTTGTAATCTCAACATGTTGGCTAATTCCAGCCTCATCTCTTCAAATTTCTCTACTTTACTATTTCTTAGAAATCAGAA
AGTTGCTACTAGAATTTCATTAGCAAACTGTGACAAAATCAAGAAAAATCCACCCAAGACTCAATTTTTAAAAAACTCAATCTCACGATT
TGGGGTAAAGGGTAGTCTTCTTTATGTATGTCATAGTTCGTTAAATCTTCAAAATCAACAAGACCCATCT
(5')ATGGAAAAAGATTTAG
CTGGTTCTACAGAGGAGAATGAGCTTGGTGGTGGAAGTAATAATGGAGACCAATGGGATTGGACGACGTCGTTTGTACTGTTTGGCTTGT
GGTCTGGACTCATGTACTATGTTTTCTTCCTTGCTCCTAACCAGACCCCGTTGACAGACGTGTATTTCTTAAAAAAGCTCCTTAATTTGA
AAGGAGATGATGGATTCCGTATGAATGAAGTGCTAGTGGGACTTTGGTATATCATGGGTTTATGGCCATTAGTTTACAGTATGCTGCTCC
TTCCTACTGCTAGAAGTTCAAAAGGCGGCATTCCTGTTTGGCCTTTTCTTGTACTTTCATGCTTTGGTGGTGCATATGTTCTCATTCCTT
ATTTTGCTCTCTGGAAACCACCACCTCCACCTGTTGAAGAAACTGAGCTTCAAAGGTTACCTTTGAATTTGCTTGAATCTAAGCTAACAG
CAGGGGGXCTAGGGATAATATTTTATGCAGGTTTATCGAGTGGAGATGTCTGGAAGGAATTTTACCAATACTTCAGAGAAAGCAGATTCG
TCCATGCGACGTCGATTGATTTCAGTTTACTATCGGTATTTGCACCCTTCTGGATTTACAATGATATGACTGCTCCAAAGTGGTATGACA
AAGGATCTTGGCTTCTTCCGCTGTCGGTGATCCCTTTTTTGGGTCCAGCACTATACCTTCTCCTACGCCCATCTCTTCCAACAGTACCAG
CCTTATCAAGCCCAACTTCgACTGAGGAAAAATGATACAGATTTCTTACACAAGGATTCTACTAGCATGGTACATTGA(3')GCAAATAT
TACAGACTGGTGAAAACTCTGCTGTCTGTAATGTACAGTAAAGAGCACAAACAACAACAAACTGTTTTTTCAGGTTATCACCTGCTCTGT
AGAGCATAGATCAGCAGTTGAAATGAAGACCATTTATGGTGGAAATTACTAACTTGTTGCTCGTCTTTTCTTCTTAATTCTATTATACTG
CTATTGCTTTATATTAATTTTCACACGATGCATATAATTTCCAATTTCAAGTATACTATAATTTCATCTATAGTTGACAATTTTCACAAC
CCTCGTAATGGGCAAGTGTAATAACTAGAGATTCTTTCATATATCTTTATGTATACTTGGTGATTTGTGTATTAAAAAAAAAAAAAAAAA
CCATCAATTAGCAATTAATCCAAACCATTATGGCTGCCAAAAATTCAGAGATAAAGTTTGCTATCTTCTTCGTTGGTCTTTTGACGACCA
CTTTAGTTGATATGTCTGGAATTTCGAAAATGCAAATGAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan