ESTScan Details for Unigene SGN-U581091

Score 
306
Direction 
Forward
Predicted Peptide Sequence 
XNSPEIYFLHNFTSSDSHNKPSNPSDHNRGHNRYVHFLNSLLPSKRLFVIPHSVSFCRSFSTVDLRIGNISDDSVVTQNENTDLLISENI
SANVEESILPVRALISLLDGYHDLTGFPWWIIIVSSAVAFRLTVIPVCIIATPQVEENWRVFPKLPPPLPPPMSGRSLRDQLKIFFKEKE
QQAVLHFFGTSLSDSSGALLSSLDYDYXKNVTAHHEGFDCGGILWFQNLTEVPSGVLGPVFPLLIAGLHYINVQVSFRKSSVEKMSGFVG
LIA
Predicted Coding Sequence 
XXGAATTCGCCGGAAATATACTTTCTCCACAATTTCACTTCTTCAGATTCTCACAATAAACCCTCAAACCCTTCCGATCACAACCGTGGG
CACAACCGGTATGTCCATTTTTTGAACTCGTTGTTACCATCAAAGCGGCTATTTGTTATTCCGCACAGTGTTTCCTTCTGCCGTTCCTTC
TCCACTGTCGACTTGCGAATTGGTAACATCAGTGACGACTCAGTGGTTACTCAGAATGAGAACACCGATTTGTTGATCAGCGAAAATATT
AGTGCAAATGTTGAGGAGTCCATTCTTCCAGTACGTGCCTTGATTTCGTTGCTGGATGGTTATCATGACCTCACTGGCTTCCCATGGTGG
ATCATTATAGTTTCTTCAGCAGTGGCTTTCAGGCTTACXGTTATTCCCGTTTGTATTATTGCAACTCCACAAGTTGAAGAGAATTGGAGA
GTTTTTCCTAAATTGCCTCCTCCACTGCCTCCGCCTATGTCAGGAAGGAGTCTTAGAGACCAACTTAAAATCTTTTTCAAGGAGAAAGAG
CAGCAGGCTGTCCTTCATTTTTTTGGTACTTCCCTCTCTGACAGTTCAGGTGCCCTGCTTTCTTCTTTGGATTACGACTATNAGAAGAAT
GTCACTGCTCATCATGAAGGCTTTGATTGTGGGGGCATTCTTTGGTTTCAGAACTTGACTGAGGTCCCTAGTGGTGTTTTAGGGCCAGTC
TTTCCATTACTGATTGCTGGATTGCATTATATTAACGTTCAGGTATCTTTTCGGAAATCTTCAGTTGAAAAAATGAGTGGATTCGTGGGA
TTAATAGCC
Edits in Original Sequence 
(5')XXGAATTCGCCGGAAATATACTTTCTCCACAATTTCACTTCTTCAGATTCTCACAATAAACCCTCAAACCCTTCCGATCACAACCG
TGGGCACAACCGGTATGTCCATTTTTTGAACTCGTTGTTACCATCAAAGCGGCTATTTGTTATTCCGCACAGTGTTTCCTTCTGCCGTTC
CTTCTCCACTGTCGACTTGCGAATTGGTAACATCAGTGACGACTCAGTGGTTACTCAGAATGAGAACACCGATTTGTTGATCAGCGAAAA
TATTAGTGCAAATGTTGAGGAGTCCATTCTTCCAGTACGTGCCTTGATTTCGTTGCTGGATGGTTATCATGACCTCACTGGCTTCCCATG
GTGGATCATTATAGTTTCTTCAGCAGTGGCTTTCAGGCTTACXGTTATTCCCGTTTGTATTATTGCAACTCCACAAGTTGAAGAGAATTG
GAGAGTTaTTTCCTAAATTGCCTCCTCCACTGCCTCCGCCTATGTCAGGAAGGAGTCTTAGAGACCAACTTAAAATCTTTTTCAAGGAGA
AAcGAGCAGCAGGCTGTCCTTCATTTTTTTGGTACTTCgCCTCTCTGACAGTTCAGGTGCCCTGCTTTCTTCTTTGGATTACGACTATNA
GAAGAATGTCACTGCaTCATCATGAAGGCTTTGATTGTGGGGGCATTCTTTGGTTTCAGAACTTGACTGAGGTCCCTAGTGGTGTTTTAG
GGCCAGTCTTTCCATTACTGATTGCTGGATTGCATTATATTAACGTTCAGGTATCTTTTCGGAAATCTTCAGTTGAAAAAATGAGTGGAT
TCGTGGGATTAATAGCC(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan