ESTScan Details for Unigene SGN-U581107

Score 
1778
Direction 
Forward
Predicted Peptide Sequence 
MAENTEIDDRVDLDDENYSEEEEDADAELVEDEGAGEVGDENGEEQSYDSGGGDSGREQSPEADMGDVSEPAADEEKPSASLSEEEQKEH
AELLALPPHGSEVFIGGIPRDVSEEDLRDLCEPLGEIHEVRVMRNRDTGESKGFAFVAFKTKDEAQKTIEELHNKEYKGKTLRCSLSETK
YRLFIGNVPKSWSDDDFRKVIDGTGPGAELIELIKDPQNPARNRGFAFVEYYNNACADYSRRKMVSTNFKLEGNSPTVTWADPKITPDHS
SAAAQVKALYVKNIPENTPTEQLKELFQRHGEVTRVVMPPAKVGGKRDFGFVHYAERSSALKAVKDTETYEVNGQMLEVVLAKPQTEKKF
DAASPHNAMPHHNYIPHPGYGAFPMNPYAPLTAGYGAAAAAAAAAFQQPMIYGRGPMPTGMQMVPMVLPDGQIGYVLQQPGVQAPPVRPR
RNDRNNGAGGPQGRGGGSSGGSDDSNRGRRYRPY*
Predicted Coding Sequence 
ATGGCAGAGAATACTGAAATTGATGACCGTGTGGATCTTGACGATGAAAATTACTCTGAGGAAGAGGAAGATGCAGATGCAGAACTGGTA
GAAGATGAAGGAGCTGGAGAAGTCGGTGATGAAAATGGCGAAGAACAATCATATGATTCTGGAGGTGGAGACAGTGGGAGAGAGCAGTCT
CCAGAGGCAGATATGGGTGATGTTTCGGAGCCTGCTGCAGATGAAGAAAAGCCTAGTGCTTCTCTTTCTGAAGAGGAACAAAAAGAGCAT
GCTGAACTTCTAGCTCTCCCTCCACATGGGTCTGAGGTTTTTATTGGTGGTATTCCTCGAGATGTTTCTGAAGAAGACTTGAGGGATCTC
TGTGAACCACTCGGTGAAATACATGAGGTCAGAGTCATGAGAAATAGGGATACTGGTGAAAGCAAGGGTTTTGCCTTTGTAGCATTCAAA
ACAAAAGATGAGGCACAAAAGACTATTGAAGAATTGCATAACAAAGAATATAAGGGAAAAACCTTAAGGTGTTCGCTGTCAGAAACTAAA
TACAGATTGTTCATTGGTAATGTACCAAAGAGCTGGTCTGATGATGACTTCAGAAAAGTCATTGATGGGACTGGTCCTGGTGCAGAATTA
ATAGAACTCATAAAGGATCCTCAAAACCCAGCACGTAATAGGGGTTTTGCTTTTGTTGAATATTACAATAATGCCTGTGCGGATTACTCT
CGGAGAAAAATGGTAAGTACAAACTTTAAGCTGGAGGGAAATTCACCAACTGTCACCTGGGCTGATCCGAAGATTACACCTGATCATTCT
TCTGCCGCTGCTCAGGTCAAAGCACTCTATGTGAAGAACATTCCAGAAAACACTCCTACTGAACAATTGAAGGAATTGTTCCAACGCCAT
GGTGAAGTTACCAGAGTTGTTATGCCACCAGCCAAGGTTGGTGGTAAACGAGACTTTGGATTTGTCCATTATGCAGAAAGGTCAAGCGCT
CTGAAAGCTGTCAAAGACACTGAAACATATGAAGTAAATGGTCAGATGTTAGAAGTAGTTCTTGCAAAGCCTCAGACTGAAAAGAAGTTT
GATGCAGCTAGTCCTCACAATGCGATGCCACATCATAATTATATTCCCCATCCAGGCTATGGTGCATTTCCGATGAACCCGTATGCACCT
CTAACTGCTGGTTATGGTGCTGCTGCTGCTGCTGCTGCCGCTGCGTTCCAACAACCTATGATATATGGTAGAGGACCGATGCCAACAGGT
ATGCAGATGGTGCCAATGGTTTTACCAGATGGTCAGATCGGCTATGTCCTCCAGCAGCCAGGAGTTCAGGCACCACCTGTTCGGCCTCGT
AGGAATGACAGGAACAATGGTGCCGGTGGACCACAAGGACGAGGAGGAGGATCCAGTGGTGGCAGTGATGATTCCAACCGTGGTAGACGT
TATCGACCATATTAG
Edits in Original Sequence 
AGAGGTGTAGAGAGTACCAAATACCCAAATTAGGGCCAAATTGGGAAGACACTGAAATCGCAGGCAGTATATAAAAGAAGTCGAAAGAGC
ATTTTTGTGTGTGTAAATTTCACTGTATTGTTGAGATTTAGCTTCTTCGCCTTCAAACTCTCTCCTCCTAAAGAAGCAGAAACACAACAC
AGATAAGCAAAAAACTTGTCTAATTTTGGGCCTGTTTATTTGTTGTATGAGAAAATCTGCAACACGAAACAGTC
(5')ATGGCAGAGAAT
ACTGAAATTGATGACCGTGTGGATCTTGACGATGAAAATTACTCTGAGGAAGAGGAAGATGCAGATGCAGAACTGGTAGAAGATGAAGGA
GCTGGAGAAGTCGGTGATGAAAATGGCGAAGAACAATCATATGATTCTGGAGGTGGAGACAGTGGGAGAGAGCAGTCTCCAGAGGCAGAT
ATGGGTGATGTTTCGGAGCCTGCTGCAGATGAAGAAAAGCCTAGTGCTTCTCTTTCTGAAGAGGAACAAAAAGAGCATGCTGAACTTCTA
GCTCTCCCTCCACATGGGTCTGAGGTTTTTATTGGTGGTATTCCTCGAGATGTTTCTGAAGAAGACTTGAGGGATCTCTGTGAACCACTC
GGTGAAATACATGAGGTCAGAGTCATGAGAAATAGGGATACTGGTGAAAGCAAGGGTTTTGCCTTTGTAGCATTCAAAACAAAAGATGAG
GCACAAAAGACTATTGAAGAATTGCATAACAAAGAATATAAGGGAAAAACCTTAAGGTGTTCGCTGTCAGAAACTAAATACAGATTGTTC
ATTGGTAATGTACCAAAGAGCTGGTCTGATGATGACTTCAGAAAAGTCATTGATGGGACTGGTCCTGGTGCAGAATTAATAGAACTCATA
AAGGATCCTCAAAACCCAGCACGTAATAGGGGTTTTGCTTTTGTTGAATATTACAATAATGCCTGTGCGGATTACTCTCGGAGAAAAATG
GTAAGTACAAACTTTAAGCTGGAGGGAAATTCACCAACTGTCACCTGGGCTGATCCGAAGATTACACCTGATCATTCTTCTGCCGCTGCT
CAGGTCAAAGCACTCTATGTGAAGAACATTCCAGAAAACACTCCTACTGAACAATTGAAGGAATTGTTCCAACGCCATGGTGAAGTTACC
AGAGTTGTTATGCCACCAGCCAAGGTTGGTGGTAAACGAGACTTTGGATTTGTCCATTATGCAGAAAGGTCAAGCGCTCTGAAAGCTGTC
AAAGACACTGAAACATATGAAGTAAATGGTCAGATGTTAGAAGTAGTTCTTGCAAAGCCTCAGACTGAAAAGAAGTTTGATGCAGCTAGT
CCTCACAATGCGATGCCACATCATAATTATATTCCCCATCCAGGCTATGGTGCATTTCCGATGAACCCGTATGCACCTCTAACTGCTGGT
TATGGTGCTGCTGCTGCTGCTGCTGCCGCTGCGTTCCAACAACCTATGATATATGGTAGAGGACCGATGCCAACAGGTATGCAGATGGTG
CCAATGGTTTTACCAGATGGTCAGATCGGCTATGTCCTCCAGCAGCCAGGAGTTCAGGCACCACCTGTTCGGCCTCGTAGGAATGACAGG
AACAATGGTGCCGGTGGACCACAAGGACGAGGAGGAGGATCCAGTGGTGGCAGTGATGATTCCAACCGTGGTAGACGTTATCGACCATAT
TAG(3')AGTCGGTGTAATGTTGTACTTGCTACTTACATTGAACACCAGACGAGTAATCCAGGACACAACTATTTCCTGTTTCCTCTTTA
TTTATAAAAAGGAAACTTAGTTAAAGTAAAAACTTAGACCAATCTCAGCAACTTAATGCGCACTGTAACTAAACAAAACATAGATGTTGC
CTGCTTGACTAGTTCATAAATTGCTTTATCAATTGTTGAGATGAACTGCTTAAAAAAAGAGTACTATA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan