ESTScan Details for Unigene SGN-U581176

Score 
857
Direction 
Reverse
Predicted Peptide Sequence 
XKLENPIYSLSSPENPINFFGPGKKEEEEEEVEELNSEMFSTKYSSTNSLTDLAEMDENGHPIQNKTFNQIPLFLLTELLPFLLHFLRFQ
SRVVAKLNEQKLFAFLQASSFCIIWVFIFPTSVAKSDARSISFMSSSXVGARDFVKLGMILEGIHRRDQIGLGVCXIVKGNDLDKEDELS
KPWRRIGVAVPPLLAMEVMSRFCFFVTGKVAEDLRPVKGATMLACVTLLRVATAAEEMTERHELYPGGSFDPLGLAEDPEAFAELKVKEI
KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVGGEMNLLKRSQVSGRLMTV*
Predicted Coding Sequence 
XXGAAACTTGAAAATCCAATTTATTCATTATCATCCCCTGAAAATCCCATCAATTTTTTTGGACCAGGGAAAAAAGAAGAAGAAGAAGAA
GAAGTAGAAGAATTGAACTCAGAAATGTTTTCAACTAAGTACTCATCGACTAATTCTTTAACAGACCTCGCAGAAATGGATGAAAATGGG
CACCCCATTCAAAACAAAACTTTTAACCAAATCCCATTGTTCCTCCTCACTGAACTTCTTCCATTTCTTCTTCATTTCCTCCGATTTCAA
TCCCGTGTAGTGGCAAAACTCAACGAACAAAAGCTCTTTGCTTTTCTTCAAGCTTCCTCTTTCTGTATCATCTGGGTGTTCATCTTTCCA
ACCTCTGTTGCAAAATCTGATGCCAGGTCAATATCGTTCATGTCGTCGTCGTTXGTTGGTGCACGAGACTTTGTGAAACTTGGGATGATT
CTTGAAGGTATACATCGAAGGGACCAAATTGGTTTGGGAGTTTGTGAXATTGTGAAGGGAAACGATTTGGATAAAGAAGATGAATTGTCA
AAGCCATGGAGGAGGATTGGCGTTGCTGTTCCACCATTGCTAGCAATGGAAGTGATGTCAAGGTTTTGCTTCTTTGTAACAGGGAAAGTG
GCTGAAGATTTGAGACCAGTGAAAGGTGCAACCATGCTAGCTTGTGTAACATTGCTGCGTGTGGCAACAGCTGCTGAAGAAATGACAGAG
CGGCACGAGCTCTACCCTGGTGGCAGCTTCGACCCATTAGGCCTTGCTGAAGACCCAGAGGCATTTGCTGAGCTCAAGGTAAAGGAGATC
AAGAACGGTAGACTTGCTATGTTCTCTATGTTTGGATTCTTTGTTCAAGCTATTGTCACCGGAAAGGGTCCATTGGAGAACCTTGCTGAC
CACCTTGCAGACCCCGTAAACAACAATGCCTGGGCTTTCGCCACAAACTTTGTCGGXGGGGAGATGAATCTCTTAAAACGTTCTCAAGTC
TCTGGTCGTTTGATGACAGTGTAA
Edits in Original Sequence 
(5')XXGAAACTTGAAAATCCAATTTATTCATTATCATCCCCTGAAAATCCCATCAATTTTTTTGaGACCAGGGAAAAAAGAAGAAGAAG
AAGAAGAAGTAGAAGAATTGAACTCAGAAATGTTTTCAACTAAGTACTCATCGACTAATTCTTTAACAGACCTCGCAGAtAATGGATGAA
AATGGGCACCCCATTCtAAAACAAAACTTTTAACCAAATCCCATTGTTCCTCCTCACTGAACTTCTTCCATTTCTTCTTCATTTCCTCCG
ATTTCAATCCCGTGTAGTGGCAAAACTCAACGAACAAAAGCTCTTTGCTTTTCTTCAAcGCTTCCTCTTTCTGTATCATCTGGGTGTTCA
TCTTTCCAACCTCTGTTGCAAAATCTGATGCCAGGTCAATATCGTTCATGTCGTCGTCGTTXGTTGGTGCACGAGACTTTGTGAAACTTG
GGATGATTCTTGAAGGTATACATCGAAGGGACCAAATTGGTTTGGGAGTTTGTGAXATTGTGAAGGGAAACGATTTGGATAAAGAAGATG
AATTGTCAAAGCCATGGaAGGAGGATTGGCGTTGCTGTTCCACCATTGCTAGCAATGGAAGTGATGTCAAGGTTTTGCTTCTTTGTAACA
GGGAAAGTGGCTGAAGATTTGAGACCAGTGAAAGGTGCAACCATGCTAGCTTGTGTAACATTGCTGCGTGTGGCAACAGCTGCTGAAGAA
ATGACAGAGCGGCACGAGCTCTACCCTGGTGGCAGCTTCGACCCATTAGGCCTTGCTGAAGACCCAGAGGCATTTGCTGAGCTCAAGGTA
AAGGAGATCAAGAACGGTAGACTTGCTATGTTCTCTATGTTTGGATTCTTTGTTCAAGCTATTGTCACCGGAAAGGGTCCATTGGAGAAC
CTTGCTGACCACCTTGCAGACCCCGTAAACAACAATGCCTGGGCTTTCGCCACAAACTTTGTCGGXGGGGAGATGAATCTCTTAAAACGT
TCTCAAGTCTCTGGTCGTTTGATGACAGTGTAA(3')AGATGTAGTGTGCTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan