ESTScan Details for Unigene SGN-U581239

Score 
1030
Direction 
Reverse
Predicted Peptide Sequence 
YIELNFEENKTTTTRRHYSYNFARLSHTPAGAVLIIWNKDEPMTTKTKNPSKIGPTGYWLPFFAVVSGTAPRLVIFFSNLSTFLSARRLD
XSHFKRKMWWPPIYENRKIAERIIFQLKVVPPVIKNQITIMAYTSLTSSPLVSNVSVGGTSKINNNKVSAPCSVFVPSMRRPTTRLVARA
TGDNKDTSVDVHHSSAQGGNNQGTAVERRPTRMALDVSPFGVLDPMSPDENNAADDRHYGQIIEDTMTFPGRNRASGTGEIRTPWDIHDD
ENEIKMRFDMPGLSKEDVKVSVENDMLVIKGEHKKEEDGRDKHSWGRNYSSYDTRLSLPDNVVKDKIKAELKNGVLFISIPKTEVEKKVI
DVQINNIQNRHAFVVLGSFVTLCKMYVAYEYKTSSASLQGAALRLVFWQITIYNHQDKKKLNRLNNKQPYRTKEEITLLFKFEVGTCSEV
TVSSIGTRGIAYRDINASNTIPNLNYINISKLTNQPTVQEYQEGGDAELSNANKPKDKRHEVHDGICIYDILNIRSDGECKVIYYCTTER
GVRGRTGVFDGLTLIGSDPRIAPLQFSAAMALSAITNSTKPMRVXMMIVTKQPQALNLSTEVLKKELDICLSNLFINVGTDIVLAHISLS
SSDLGRKVGLTGAIAVLEGSTFXREYPSIVPARLRALLAAFFISKLNKCKTEYRIGISTDATVNHLPAGKKECSKLLFSHLVINVRHINC
PPNNLFTLGHACPDIHPSPTKTIAISLPSVESSIALSSLHCITEGSNPNCSPPGEIGTTASWWRVREAQTLQPWGSIWKAFPPNPSLSVK
PFPTMNLITHTSISTQINTXSLSDADVENYGDPSLHCL*CFASAVEKHPFAPYAAHSFSGVAAVVDDYRHHHLNILIIXVSLTVSHRSDS
TDDQGTGIMLYNTIILRFNEPFSSTAMTVPSVTTSLTVPKTAPFSPSSLTLFPNFGFCWSKRWTPLIKEENPNSKMVSWENGNRTKFSLS
L**
Predicted Coding Sequence 
TACATTGAGCTAAACTTTGAGGAAAACAAAACTACAACAACCAGGCGCCACTACTCGTATAACTTTGCAAGATTAAGCCATACCCCCGCT
GGTGCTGTCCTTATTATCTGGAACAAAGATGAGCCAATGACAACAAAGACGAAGAATCCAAGCAAGATAGGGCCAACTGGATACTGGCTT
CCCTTCTTTGCAGTAGTTTCAGGAACAGCTCCTCGCTTGGTAATATTTTTCTCAAACCTCTCCACCTTCCTATCAGCAAGACGCCTTGAT
GXTAGTCATTTTAAAAGGAAAATGTGGTGGCCGCCGATATATGAGAACAGAAAAATTGCAGAGAGAATTATATTTCAGCTAAAAGTTGTT
CCTCCTGTGATTAAAAATCAAATAACTATAATGGCTTACACAAGTCTTACATCTTCTCCATTAGTGTCAAATGTTAGCGTTGGTGGAACC
TCTAAGATTAATAACAACAAGGTATCTGCACCTTGCTCTGTTTTCGTTCCGTCGATGAGAAGGCCGACGACTAGGCTGGTAGCTCGGGCT
ACCGGCGATAACAAAGATACGTCAGTCGACGTACACCACAGCAGTGCTCAAGGAGGAAACAACCAAGGCACTGCCGTCGAACGCCGTCCT
ACGAGGATGGCGCTTGATGTTTCCCCTTTTGGAGTGTTAGATCCAATGTCACCXGATGAGAACAATGCGGCAGATGATAGACACTATGGA
CAGATTATTGAAGATACAATGACATTTCCAGGAAGAAACAGAGCATCAGGAACAGGGGAAATACGCACTCCATGGGACATTCATGATGAT
GAAAACGAAATCAAGATGCGTTTCGACATGCCGGGACTGTCCAAGGAAGATGTAAAAGTATCAGTAGAAAATGACATGCTTGTCATTAAA
GGGGAACACAAAAAGGAAGAAGACGGAAGAGATAAACACTCATGGGGTAGGAATTATAGCTCTTACGACACTCGTTTAAGTCTCCCAGAT
AATGTTGTGAAGGATAAAATCAAAGCGGAACTGAAGAATGGAGTTCTTTTCATCTCGATTCCAAAGACTGAAGTGGAGAAAAAGGTGATT
GATGTCCAAATTAACAACATTCAGAATCGCCATGCTTTTGTTGTTCTAGGTTCATTTGTAACCTTGTGTAAAATGTATGTTGCATATGAA
TATAAAACAAGTAGTGCATCTTTGCAAGGGGCTGCTCTGAGACTTGTTTTCTGGCAAATTACAATTTACAACCATCAAGACAAGAAGAAA
TTAAATAGGCTGAATAATAAACAGCCATATAGAACAAAGGAAGAGATTACACTCCTTTTTAAGTTTGAAGTTGGAACTTGCTCAGAAGTC
ACCGTTAGCAGTATTGGTACTCGAGGCATTGCCTACAGAGACATAAATGCTAGCAATACCATACCAAACTTAAATTACATCAACATAAGC
AAACTCACAAACCAGCCAACAGTACAAGAGTATCAAGAAGGTGGAGATGCCGAGTTGAGTAACGCTAATAAACCAAAAGACAAACGCCAT
GAGGTACACGATGGTATCTGTATCTACGATATATTAAATATAAGATCAGATGGTGAATGCAAAGTGATATATTACTGCACCACCGAGCGG
GGAGTGCGCGGCCGGACAGGAGTCTTCGATGGGCTTACTCTTATAGGGAGTGATCCCAGGATTGCACCACTGCAGTTCAGTGCAGCAATG
GCACTCTCGGCCATAACAAACTCAACAAAACCTATGCGAGTAGAXATGATGATAGTCACCAAGCAACCTCAAGCGCTTAACCTCTCCACA
GAAGTACTCAAAAAAGAGCTTGACATCTGCTTGAGTAACCTTTTTATCAATGTTGGTACAGATATAGTTCTTGCACACATCTCCCTTTCA
TCTTCAGACCTTGGAAGAAAAGTTGGATTAACTGGTGCAATAGCAGTTTTAGAGGGAAGCACTTTCXACAGGGAGTATCCTAGCATAGTT
CCTGCAAGACTCAGAGCACTCCTTGCXGCCTTCTTCATCAGTAAACTCAATAAATGCAAAACGGAGTACAGAATTGGGATCTCCACAGAT
GCGACAGTCAACCACCTGCCCGCAGGTAAGAAAGAGTGTAGCAAGTTGCTCTTCAGTCACCTGGTGATCAATGTCAGACACATAAACTGT
CCTCCTAATAACCTCTTCACGTTGGGCCATGCTTGTCCGGACATTCATCCTTCTCCTACCAAGACCATAGCCATTTCTCTTCCTTCTGTT
GAAAGTTCCATCGCCTTGTCCAGTTTGCATTGCATAACTGAAGGATCAAACCCAAATTGTTCTCCACCAGGAGAGATTGGCACTACTGCT
AGTTGGTGGAGAGTGAGGGAGGCACAAACTCTTCAGCCATGGGGTTCAATTTGGAAAGCATTTCCTCCAAATCCTTCACTCTCTGTTAAA
CCCTTCCCCACCATGAACCTCATCACCCACACCTCCATTTCTACTCAAATCAACACCGXTTCATTATCTGATGCTGATGTTGAAAATTAT
GGTGACCCATCACTCCATTGCCTTTGATGCTTTGCTTCTGCTGTTGAAAAACACCCATTTGCGCCTTATGCTGCACACTCGTTTTCTGGG
GTTGCTGCTGTTGTAGATGATTACAGACATCATCATCTGAATATTCTGATCATTAXGGTATCGTTGACCGTGTCTCACCGTTCTGATTCG
ACTGATGATCAAGGCACCGGAATCATGCTTTACAACACTATCATCCTCCGATTCAACGAACCATTCTCATCCACGGCCATGACTGTTCCT
TCAGTAACAACTAGTCTCACAGTACCCAAGACTGCTCCTTTTTCTCCTTCTTCTTTAACCCTTTTTCCCAATTTCGGGTTCTGCTGGTCT
AAGCGGTGGACTCCATTAATCAAAGAAGAAAATCCAAACTCAAAGATGGTGAGCTGGGAAAATGGAAATAGAACAAAATTTTCTTTATCT
TTGTAGTGA
Edits in Original Sequence 
GATGGAGAACACAAACATTAACCACATAATGAGACGAGAAAATTTATATTTTGAGTCTCACAAATTAAAAAAACACATTACTACAAAAGT
TTTTTTTTTTTCATTTC
(5')TACATTGAGCTAAACTTTGAGGAAAACAAAACTACAACAACgCAGGCGCCACTACTCGTATAACTTTGC
AAGATTAAGCCATACCCCCGCTGGtTGCTGTCCTTATTATCTGGAACAAAGATGAGCCAATGACAACAAAGACGAAGAATCCAAGCAAGA
TAGGGCCAACTGGATACTGGCTTCCCTTCTTTGCAGTAGTTTCAGGAACAGCTCCTCGCTTGGTAATATTTTTCTCAAACCTCTCCACCT
TCCTATCAGCAAGACGCCTTGATGXTAGTCATTTTAAAAGGAAAATGTGGTGGCCGCCGATATATGAGAACAGAAAAATTGCAGAGAGAA
TTATATTTCAGCTAAAAGTTGTTCCTCCTGTGATTAAAAATCtAAATAACTATAATGGCTTACACAAGTCTTACATCTTCTCCATTAGTG
TCAAATGTTAGCGTTGGTGGAACCTCTAAGATTAATAACAACAAGGTATCTGCACCTTGCTCTGTTTTCGTTCCGTCGATGAGAAGGCCG
ACGACTAGGCTGGTAGCTCGGGCTACCGGCGATAACAAAGATACGTCAGTCGACGTACACCACAGCAGTGCTCAAGGAGGAAACAACCAA
GGCACTGCCGTCGAACGCCGTCCTACGAGGATGGCGCTTGATGTTTCCCCTTTTGGAGTGTTAGATCCAATGTCACCXGATGAGAACAAT
GCGGCAGATGATAGACACTATGGACAGATTATTcGAAGATACAATGACATTTCCAGGAAGAAACAGAGCATCAGGAACAGGGGAAATACG
CACTCCATGGGACATTCATGATGATGAAAACGAAATCAAGATGCGTTTCGACATGCCGGGACTGTCCAAGGAAGATGTAAAAGTATCAGT
AGAAAATGACATGCTTGTCATTAAAGGGGAACACAAAAAGGAAGAAGACGGAAGAGATAAACACTCATGGGGTAGGAATTATAGCTCTTA
CGACACTCGTTTAAGTCTCCCAGATAATGTTGTGAAGGATAAAATCAAAGCGGAACTGAAGAATGGAGTTCTTTTCATCTCGATTCCAAA
GACTGAAGTGGAGAAAAAGGTGATTGATGTCCAAATTAACtAACATTCAGAATCGCCATGCTTTTGTTGTTCTAGGTTCATTTGTAACCT
TGTGTAAAATGTATGTTcGCATATGAATATAAAACAAGTAGTGCATCTTTGaCAAGGGGCTGCTCTGAGACTTGTTTTCTGGCAAATTAC
AATTTACAACCATCAAGACAAGtAAGAAATTAAATAGGCTGAATAATAAACAGCCATATAGAACAAAGGAAGAGATTACACTCCTTTTTA
AGTTTGAAGTTGGAACTTGCTCAGAAGTCACCGTTAGCAGTATTGGTACTCGAGGCATTGCCTACAGAGACATAAATaGCTAGCAATACC
ATACCAAACTTAAATTACATCAACATAAGCAAACTCACAAACCAGCCAACAGTACAAGAGTATCAAGAAGGTGaGAGATGCCGAGTTGAG
TAACGCTAATAAACCAAAAGACAAACGCCATGAGGTACACGATGGTATCTGTATCTACGtATATATTAAATATAAGATCAGATGGTGAAT
GCAAAGTGATATATTACTGCACCACCGAGCGGGGAGTGCGCGGCCGGACAGGAGTCTTCGATGGGCTTACTCTTATAGGGAGTGATCCCA
GGATTGCACCACTGCAGTTCAGTGCAGCAATGGCACTCTCGGCCATAACAAACTCAACAAAACCTATGCGAGTAGAXATGATGATAGTCA
CCAAGCAACCTCAAGCGCTTAACCTCTCCACAGAAGTACTCAAAAAAGAGCTTGACATCTGCTTGAGTAACCTTTTTATCAATGTTGGTA
CAGtATATAGTTCTTGCACACATCTCCCTTTCATCTTCAGACCTTGGAAGAAAAGTTGGATTAACTGGTGCAATAGCAGTTTTAGAGGGA
AGCACTTTCXACAGGGtAGTATCCTAGCATAGTTCCTGCAAGACTCAGAGCACTCCTTGCXGCCTTCTTCATCAGTAAACTCAATAAATG
CAAAACGGAGTACAGAATTGGGATCTCCACAGATGCGACAGTCAACCACCTGCCCGCAGGTAAGAAAGAGTGTAGCAAGTTGCTCTTCAG
TCACCTGGTGATCAATGTCAGACACATAAACTGTCCTCCTAATAACCTCTTCACGTTGGGCCATGCTTGTCCGGACATTCATCCTTCTCC
TACCAAGACCATAGCCATTTCTCTTCCTTCTGTTGAAAGTTCCATCGCCTTGTCCAGTTTGCATTGCATAACTGaAAGGATCAAACCCAA
ATTGTTCTCCACCAGGAGAGATTGGCACTACTGCgTAGTTGGTGGAGAGTGAGGGAGGCACAAACTCTTCAGCCATGGGGTTCAATTTGG
AAAGCATTTCCTCCAAATCCTTCAtCTCTCTGTTAAACCCTTCCCCACCATGAACCTCATCACCCACACCTCCATTTCTACTCAAATCAA
CACCGXTTCATTATCTGATGCTGATGTTGAAAATTATGGTGACCCATCACTCCATTGCCTTTGATGCTTTGCTTCTGCTGTTGAAAAACA
CCCATTTGCGCCTTATGCTGCACACTCGTTTTCTGGGGTTGCTGCTGTTGTAGATGATTaACAGACATCATCATCTGAATATTCTGATCA
TTAXGGTATCGTTGACCGTGTCTCACCGTTCTGATTCGACTGATGATCAAcGGCACCGGAATCATGCTTTACAACACTATCATCCgTCCG
ATTCAACGAACCATTCTCATCCACGGCCATGACTGTTCCTTCAGTAACAACTAtGTCTCACAGTACCCAAGACTGCTCCTTTTTCTCCTT
CTTCTTTAACCCTTTTTCCCAATTTCGGGTTCTGCTGGTCTAAGCGGTGGACTCCATTAATCAAAGAAGAAAATCCAAACTCAAAGATGG
TGAGCTGGGAAAATGGAAATAGAACAAAATTTTCTTTATCTTTGTAGTGA(3')TGACGCGAGAGAGATGAATTTAGCTCATAGAGAAAA
CAGACGAGCTTCTTCGGATGGTCCGTTTCGCCACCCCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan