ESTScan Details for Unigene SGN-U581327

Score 
1350
Direction 
Forward
Predicted Peptide Sequence 
MGSSGGIDYGSYTYENLEREPYWPSEKLRISITGAGGFIASHIARRLKSEGHYIIASDWKKNEHMTEDMFCHEFHLADLRVMDNCLKVTK
GVDHVFNLAADMGGMGFIQSNHSVIFYNNTMISFNMMEAARINSVKRFFYASSACIYPEFKQLETNVSLKEADAWPAEPQDAYGLEKLAT
EELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGREKAPAAFCRKAQTATDKFEMWGDGLQTRSFTFIDECVEGVLRLTKSDFREPVNIGS
DEMVSMNEMAEMVLSFEDKKLPVQHIPGPEGVRGRNSDNTLIKEKLGWAPTMRLKDGLRITYFWIKEQIEKEKSQGVDTATYGSSKVVGT
QAPVELGSLRAADGKE*
Predicted Coding Sequence 
ATGGGAAGCTCTGGTGGTATTGACTATGGTTCTTACACTTATGAGAATCTTGAGAGGGAACCTTACTGGCCGTCTGAGAAGCTCCGTATT
TCCATTACTGGGGCTGGAGGGTTTATCGCTTCTCACATTGCTCGCCGTTTGAAGAGCGAGGGCCACTACATAATTGCCTCTGATTGGAAG
AAGAATGAGCACATGACAGAGGATATGTTCTGTCATGAGTTTCATCTTGCGGATCTTAGGGTTATGGATAATTGCTTGAAGGTAACAAAA
GGTGTTGACCATGTCTTCAACCTTGCTGCTGATATGGGTGGCATGGGTTTCATTCAGTCCAACCACTCTGTTATCTTCTATAACAACACT
ATGATCAGCTTCAATATGATGGAAGCTGCTAGGATTAACAGTGTCAAAAGGTTCTTCTATGCATCTAGCGCTTGCATATACCCTGAGTTC
AAACAACTTGAAACAAATGTCAGCCTGAAAGAAGCTGATGCATGGCCTGCAGAGCCTCAAGATGCATATGGTTTGGAGAAGCTTGCCACA
GAAGAATTGTGCAAACATTACAACAAGGATTTTGGAATTGAATGTCGTATTGGAAGGTTCCATAACATCTATGGACCTTTTGGAACCTGG
AAAGGTGGAAGGGAAAAAGCTCCTGCCGCTTTTTGTAGAAAAGCACAAACTGCAACGGATAAGTTTGAAATGTGGGGAGATGGACTTCAA
ACACGTTCATTCACCTTCATTGATGAGTGTGTTGAAGGGGTTCTTAGATTGACAAAATCCGACTTCCGTGAGCCAGTAAACATTGGAAGT
GATGAGATGGTCAGCATGAATGAGATGGCTGAGATGGTCCTCAGCTTTGAGGACAAGAAGCTTCCTGTCCAACACATTCCTGGCCCAGAA
GGCGTCCGTGGTCGCAACTCAGACAACACGCTGATTAAAGAGAAGCTTGGTTGGGCTCCAACAATGAGATTGAAGGATGGTCTGAGAATT
ACATACTTCTGGATCAAGGAGCAGATCGAGAAAGAGAAATCTCAAGGAGTTGATACTGCAACCTATGGATCTTCCAAGGTTGTGGGCACC
CAAGCTCCAGTTGAGCTAGGTTCCCTCCGTGCTGCTGATGGCAAGGAATAA
Edits in Original Sequence 
CCAAATTGTTGTTATCATAATTGTCTCTCAACCATTCAACTCTCTTTCTAATATCTCAATCTTTTTCTCCTCCATACTTTTACAGA(5')
ATGGGAAGCTCTGGTGGTATTGACTATGGTTCTTACACTTATGAGAATCTTGAGAGGGAACCTTACTGGCCGTCTGAGAAGCTCCGTATT
TCCATTACTGGGGCTGGAGGGTTTATCGCTTCTCACATTGCTCGCCGTTTGAAGAGCGAGGGCCACTACATAATTGCCTCTGATTGGAAG
AAGAATGAGCACATGACAGAGGATATGTTCTGTCATGAGTTTCATCTTGCGGATCTTAGGGTTATGGATAATTGCTTGAAGGTAACAAAA
GGTGTTGACCATGTCTTCAACCTTGCTGCTGATATGGGTGGCATGGGTTTCATTCAGTCCAACCACTCTGTTATCTTCTATAACAACACT
ATGATCAGCTTCAATATGATGGAAGCTGCTAGGATTAACAGTGTCAAAAGGTTCTTCTATGCATCTAGCGCTTGCATATACCCTGAGTTC
AAACAACTTGAAACAAATGTCAGCCTGAAAGAAGCTGATGCATGGCCTGCAGAGCCTCAAGATGCATATGGTTTGGAGAAGCTTGCCACA
GAAGAATTGTGCAAACATTACAACAAGGATTTTGGAATTGAATGTCGTATTGGAAGGTTCCATAACATCTATGGACCTTTTGGAACCTGG
AAAGGTGGAAGGGAAAAAGCTCCTGCCGCTTTTTGTAGAAAAGCACAAACTGCAACGGATAAGTTTGAAATGTGGGGAGATGGACTTCAA
ACACGTTCATTCACCTTCATTGATGAGTGTGTTGAAGGGGTTCTTAGATTGACAAAATCCGACTTCCGTGAGCCAGTAAACATTGGAAGT
GATGAGATGGTCAGCATGAATGAGATGGCTGAGATGGTCCTCAGCTTTGAGGACAAGAAGCTTCCTGTCCAACACATTCCTGGCCCAGAA
GGCGTCCGTGGTCGCAACTCAGACAACACGCTGATTAAAGAGAAGCTTGGTTGGGCTCCAACAATGAGATTGAAGGATGGTCTGAGAATT
ACATACTTCTGGATCAAGGAGCAGATCGAGAAAGAGAAATCTCAAGGAGTTGATACTGCAACCTATGGATCTTCCAAGGTTGTGGGCACC
CAAGCTCCAGTTGAGCTAGGTTCCCTCCGTGCTGCTGATGGCAAGGAATAA(3')GTTGATTCCTTCTGTCATCATTTCAATTGGAAGCC
AATCCATCTGCTATGACATTGCTGCATTATGTATTATGGCGTCGTAGAAGATGTGTTAGATTCTGGTAATTGTTGGCGTTTCTTGGTTTT
AGTTTGAACATGTCAATGTAATCTATTACCCCATGGTCTTGTGAAGGGGATAGTTTAATAGTTCATCTATATTTATCAGTCGTTCGAGAA
GATCTCAATGTGAGAACTGAATAACTGCCAGTGGATCCTCTCTTGTTTTTTTTACCTAGTTCAGGATCTTGCTGTTGTGCTGTTGGTGAT
CATGTAATCAAAATTTTAACCTTGATAAGGTTTAAAGATATGTGAGATTTCATTGCATAGATATTATTCTTCATATAGCAATGAGATTGA
AATTTTCTAAGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan