ESTScan Details for Unigene SGN-U581372

Score 
553
Direction 
Forward
Predicted Peptide Sequence 
XRPKDILYTTAVSDFTAIYSFPIQSVFAGFVPISRCCCFPNSQRIEIGEFDMAGKIMHAVQYDSYDGGAAALKHVEVPVPTPKKDEVLLK
LEAASINPVDWKIQKGVLRPLLPTKFPFIPTTDVGGEVVEVGSNVKSFKAGDKVVAMLNTLVGQILFICLIFATSLLHFGPWSKPVSEGP
AQSLHSFSMDVVIVPCSLNSTSFVFGLLLGAKSPHSNPPPHGTTDFPTDLNLNRFGXEVEAPWVEQPAHLNFEYSSSLTNSFYFECHVVI
LCSIVYDXMDLHXALIQNGGGLAEYAVANESLTVPRPAEVSAAEGAGLVIAGLTALQALVNPAEVKLDGTGPPERX
Predicted Coding Sequence 
XGTCGCCCAAAAGATATACTCTATACTACTGCCGTCTCCGATTTCACCGCTATATATTCATTTCCTATACAATCTGTTTTCGCAGGTTTT
GTTCCAATTTCAAGGTGTTGTTGCTTCCCCAATTCACAGAGAATTGAAATTGGTGAATTTGATATGGCTGGAAAGATTATGCATGCTGTT
CAGTACGACTCTTATGACGGTGGAGCCGCTGCCTTGAAGCATGTGGAAGTTCCTGTCCCAACTCCGAAGAAGGATGAGGTCTTGCTAAAA
CTCGAGGCTGCAAGCATAAATCCTGTTGACTGGAAAATTCAGAAGGGCGTGCTTCGTCCCCTTCTTCCTACCAAGTTTCCTTTTATTCCT
ACTACCGACGTGGGAGGAGAGGTTGTAGAGGTAGGATCTAATGTAAAAAGCTTCAAGGCTGGTGACAAGGTTGTGGCTATGCTCAATACC
CTGGTTGGTCAAATTCTTTTCATATGTCTTATTTTCGCTACATCTCTCTTACATTTTGGACCTTGGTCTAAACCAGTAAGCGAGGGACCT
GCTCAGAGTTTACATTCGTTTTCTATGGATGTTGTTATTGTTCCTTGTTCTCTAAATTCTACTAGTTTTGTTTTTGGTTTACTTTTGGGG
GCCAAGTCCCCTCATTCAAACCCTCCTCCCCATGGGACTACTGATTTTCCAACTGACTTGAATCTTAACCGTTTTGGTXTGGAAGTGGAG
GCACCATGGGTAGAGCAACCTGCTCATCTTAACTTTGAATATTCCTCCTCATTAACTAATTCATTTTACTTTGAATGTCATGTGGTGATA
TTGTGTTCTATCGTTTATGATXTGATGGATCTTCATGXAGCTTTGATACAGAATGGAGGTGGATTGGCTGAATATGCGGTGGCTAATGAG
AGTTTGACTGTTCCAAGACCCGCTGAAGTATCAGCTGCAGAAGGTGCAGGTCTTGTTATTGCAGGTCTTACAGCTCTTCAGGCCCTTGTC
AATCCTGCTGAGGTTAAGCTCGATGGAACTGGACCXCCGGAAAGACXX
Edits in Original Sequence 
(5')XGTCGCCCAAAAGATATACTCTATACTACTGCCGTCTaCCGATTTCACCGCTATATATTCATTTCCTATACAATCTGTTTTCGCAG
GTTTTGTTCCAATTTCAAGGTGTTGTTGCTTCCCCAATTCACAGAGAATTGAAATTGGTGAATTTGATATGGCTGGAAAGATTATGCATG
CTGTTCAGTACGACTCTTATGACGGTGGAGCCGCTGCCTTGAAGCATGTGGAAGTTCCTGTCCCAACTCCGAAGAAGGATGAGGTCTTGC
TAAAACTCGAGGCTGCAAGCATAAATCCTGTTGACTGGAAAATTCAGAAGGGCGTGCTTCGTCCCCTTCTTCCTACCAAGTTTCCTTTTA
TTCCTACTACCGACGTGGGAGGAGAGGTTGTAGAGGTAGGATCTAATGTAAAAAGCTTCAAGGCTGGTGACAAGGTTGTGGCTATGCTCA
ATACCCTGGTTGGTCAAATTCTTTTCATATGTCTTATTTTCGCTACATCTCTCTTACATTTTGGACCTTGGTCTAAACCAGTAAGCGAGG
GACCTGCTCAGAGTTTACATTCGTTTTCTATGGATGTTGTTATTGTTCCTTGTTCTCTAAATTCTACtTAGTTTTGTTTTTGGTTTACTT
TTGGGGGCCAAGTCCCCTCATTCAAACCCTCCTCCCCATGGGACTACTGtATTTTCCAACTGACTTGAATCTTAACCGTTTTGGTXTGGA
AGTGGAGGCACCATGGGTAGAGCAACCTGCTCATCTTAACTTTGtAATATTCCTCCTCATTAACTAATTCATTTTACTTTGAATaGTCAT
GTGGTGATATTGTGTTCTATCGTTTATGATXTGATGGATCTTCATGXAGCTTTGATACAGAATGGAGGTGGATTGGCTGAATATGCGGTG
GCTAATGAGAGTTTGACTGTTCCAAGACCCGCTGAAGTATCAGCTGCAGAAGGTGCAGGTCTTGTTATTGCAGGTCTTACAGCTCTTCAG
GCCCTTGTCAATCCTGCTGAGGTTAAGCTCGATGGAACTGGACCXCCGGAAAGACXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan